Citrus Sinensis ID: 042782


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------
MYQTKTKTKVKTKTIFCVLCWCCLNYLAIKLAEKELLSMASKLLLTFAICRLIVTVGLTMDPTELLRLGVYGQLSVDPFDVQTASLDFGMLSRAEPWAVLHPASADDITRVVKAAYESEAHGFTISARGHGHSINGQAQTSNGVVIQMSGSRGRRLGSSTPAALRPHVYEKERYVDVWGGELWIDVLRSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHQGPQITNVHELDVVTGKGELLTCSEEQNSGLFHAVLGGLGQFGIITRARISLEPAPKRVRWIRVLYSDFSTFTRDQEYLISLHELPASQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKITSLGTDGGVLYCLEITKNYDESTADTTDQEVESLLKKLNFIQSSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFIPKSRIADFDKGVFKGILGNKTGGPILIYPMNKHKWDNRSSVVTPDEDVFYLVAFLRSALDNGEEMQSLEYLNHQNRQILKFCDEAGIKAKQYLPHYTTQE
cccccccCEEEEccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHccccccEEccccccHHHHHHHccccccccccEEECcccHHHHHHHHHHHHHccccccEEEEccccccccccccccccEEEEccccccccccccccccccccccccccEEECcccccHHHHHHHHHHccccccccccccEEEEEEEEccccccccccccccccccEEEEEEEEccccEEEccccccccHHHHHHcccccEEEEEEEEEEEECcccEEEEEEEEEcccccHHHHHHHHHHcccccccccccEEEEEEEccccccccccccccccccccccccccccccEEEEEEEEEccccccccccHHHHHHHHHHccccccccEEccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccccccccEEEEEccccccccccccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccccEEccccccccc
**********KTKTIFCVLCWCCLNYLAIKLAEKELLSMASKLLLTFAICRLIVTVGLTMDPTELLRLGVYGQLSVDPFDVQTASLDFGMLSRAEPWAVLHPASADDITRVVKAAYESEAHGFTISARGHGHSINGQAQTSNGVVIQMSGSRGRR*****PAALRPHVYEKERYVDVWGGELWIDVLRSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHQGPQITNVHELDVVTGKGELLTCSEEQNSGLFHAVLGGLGQFGIITRARISLEPAPKRVRWIRVLYSDFSTFTRDQEYLISLHELPASQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKITSLGTDGGVLYCLEITKNYDESTADTTDQEVESLLKKLNFIQSSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFIPKSRIADFDKGVFKGILGNKTGGPILIYPMNKHKWDNRSSVVTPDEDVFYLVAFLRSALDNGEEMQSLEYLNHQNRQILKFCDEAGIKAKQYLPH*****
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYQTKTKTKVKTKTIFCVLCWCCLNYLAIKLAEKELLSMASKLLLTFAICRLIVTVGLTMDPTELLRLGVYGQLSVDPFDVQTASLDFGMLSRAEPWAVLHPASADDITRVVKAAYESEAHGFTISARGHGHSINGQAQTSNGVVIQMSGSRGRRLGSSTPAALRPHVYEKERYVDVWGGELWIDVLRSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHQGPQITNVHELDVVTGKGELLTCSEEQNSGLFHAVLGGLGQFGIITRARISLEPAPKRVRWIRVLYSDFSTFTRDQEYLISLHELPASQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKITSLGTDGGVLYCLEITKNYDESTADTTDQEVESLLKKLNFIQSSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFIPKSRIADFDKGVFKGILGNKTGGPILIYPMNKHKWDNRSSVVTPDEDVFYLVAFLRSALDNGEEMQSLEYLNHQNRQILKFCDEAGIKAKQYLPHYTTQE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytokinin dehydrogenase 5 Catalyzes the oxidation of cytokinins, a family of N(6)-substituted adenine derivatives that are plant hormones, where the substituent is an isopentenyl group.confidentQ67YU0
Cytokinin dehydrogenase 5 Catalyzes the oxidation of cytokinins, a family of N(6)-substituted adenine derivatives that are plant hormones, where the substituent is an isopentenyl group.probableQ5ZAY9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.5.-.-Acting on the CH-NH group of donors.probable
1.5.99.-With other acceptors.probable
1.5.99.12Cytokinin dehydrogenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EXR, chain A
Confidence level:very confident
Coverage over the Query: 65-153,165-526
View the alignment between query and template
View the model in PyMOL
Template: 3S1D, chain A
Confidence level:very confident
Coverage over the Query: 62-527
View the alignment between query and template
View the model in PyMOL