Citrus Sinensis ID: 042788


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MLNFELLKKDFMQMQVSQAAFFGLLVAVAAMIITIAVYLCSIKKSRGSLDPENFKEFKLTKRTPISHNTAKFRFALPKSTSILGLPVGQHILCRGKDSEGNEVIRPYTPITLDSDIGYFELVVKMYPKGRMAHHFREMHEGEYLPVKGPKGRLKYKVGQARAFGMIAGGTGITPMFQLTRAILENPKDKTNVHLIYANVTVGDILLKDELDSFATNSPNRFKVYYVLSQPTEVWNGGIGHVSKEMIQMHCPTPAPDIQ
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEECcccEEEEEECccccccccccccccEEEEEEEcccccEEEEEEccccccccccEEEEEEEEcccccccccccccccccEEEEEccccccccccccccEEEEEEccccHHHHHHHHHHHHcccccccEEEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccHHHHHHHccccccccc
**NFELLKKDFMQMQVSQAAFFGLLVAVAAMIITIAVYLCSIKKS********FKEFKLTKRTPISHNTAKFRFALPKSTSILGLPVGQHILCRGKDSEGNEVIRPYTPITLDSDIGYFELVVKMYPKGRMAHHFREMHEGEYLPVKGPKGRLKYKVGQARAFGMIAGGTGITPMFQLTRAILENPKDKTNVHLIYANVTVGDILLKDELDSFATNSPNRFKVYYVLSQPTEVWNGGIGHVSKEMIQM***T******
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNFELLKKDFMQMQVSQAAFFGLLVAVAAMIITIAVYLCSIKKSRGSLDPENFKEFKLTKRTPISHNTAKFRFALPKSTSILGLPVGQHILCRGKDSEGNEVIRPYTPITLDSDIGYFELVVKMYPKGRMAHHFREMHEGEYLPVKGPKGRLKYKVGQARAFGMIAGGTGITPMFQLTRAILENPKDKTNVHLIYANVTVGDILLKDELDSFATNSPNRFKVYYVLSQPTEVWNGGIGHVSKEMIQMHCPTPAPDIQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH--cytochrome b5 reductase 1 Reductase transfering electrons from NADH to cytochrome b5. Required for the NADH-dependent electron transfer involved in the desaturation and hydroxylation of fatty acids and in the desaturation of sterol precursors. No activity with NADPH as electron donor.probableQ9ZNT1
NADH-cytochrome b5 reductase 1 Electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system supports the catalytic activity of several sterol biosynthetic enzymes.probableA3GF86
NADH-cytochrome b5 reductase 1 Electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system supports the catalytic activity of several sterol biosynthetic enzymes.probableQ2UFN3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.6.-.-Acting on NADH or NADPH.probable
1.6.2.-With a heme protein as acceptor.probable
1.6.2.2Cytochrome-b5 reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMK, chain A
Confidence level:very confident
Coverage over the Query: 43-253
View the alignment between query and template
View the model in PyMOL