Citrus Sinensis ID: 042788
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| 224131714 | 278 | predicted protein [Populus trichocarpa] | 0.953 | 0.884 | 0.699 | 1e-100 | |
| 296085353 | 289 | unnamed protein product [Vitis vinifera] | 0.914 | 0.816 | 0.711 | 1e-99 | |
| 225449782 | 292 | PREDICTED: NADH-cytochrome b5 reductase | 0.914 | 0.808 | 0.711 | 2e-99 | |
| 55979111 | 280 | NADH:cytochrome b5 reductase [Vernicia f | 0.957 | 0.882 | 0.68 | 4e-98 | |
| 255573283 | 279 | NADH-cytochrome B5 reductase, putative [ | 0.949 | 0.878 | 0.682 | 1e-97 | |
| 225436003 | 278 | PREDICTED: NADH-cytochrome b5 reductase | 0.910 | 0.845 | 0.719 | 4e-97 | |
| 356504288 | 278 | PREDICTED: NADH-cytochrome b5 reductase | 0.957 | 0.888 | 0.674 | 4e-96 | |
| 255637950 | 278 | unknown [Glycine max] | 0.957 | 0.888 | 0.674 | 5e-96 | |
| 224110072 | 280 | predicted protein [Populus trichocarpa] | 0.957 | 0.882 | 0.681 | 4e-95 | |
| 449437668 | 280 | PREDICTED: NADH--cytochrome b5 reductase | 0.949 | 0.875 | 0.672 | 4e-95 |
| >gi|224131714|ref|XP_002328090.1| predicted protein [Populus trichocarpa] gi|222837605|gb|EEE75970.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 371 bits (953), Expect = e-100, Method: Compositional matrix adjust.
Identities = 172/246 (69%), Positives = 199/246 (80%)
Query: 13 QMQVSQAAFFGLLVAVAAMIITIAVYLCSIKKSRGSLDPENFKEFKLTKRTPISHNTAKF 72
+Q +A G+ VA+ A+ + A Y KK +G LDPENFKEFKL KRT +SHN AKF
Sbjct: 3 NLQSHRAEMIGIAVALVAIGASTAFYFYITKKPKGCLDPENFKEFKLVKRTELSHNVAKF 62
Query: 73 RFALPKSTSILGLPVGQHILCRGKDSEGNEVIRPYTPITLDSDIGYFELVVKMYPKGRMA 132
+FALPK S+LGLP+GQH+ CRGKDS G EVI+PYTP TLDSD+G FELV+KMYP+GRM+
Sbjct: 63 KFALPKPNSVLGLPIGQHMSCRGKDSAGEEVIKPYTPTTLDSDLGCFELVIKMYPQGRMS 122
Query: 133 HHFREMHEGEYLPVKGPKGRLKYKVGQARAFGMIAGGTGITPMFQLTRAILENPKDKTNV 192
HHFREM EG+YL VKGPKGR KY+ Q RAFGMIAGGTGITPMFQ+TRAILENP DKTN+
Sbjct: 123 HHFREMREGDYLAVKGPKGRFKYQPNQVRAFGMIAGGTGITPMFQVTRAILENPNDKTNI 182
Query: 193 HLIYANVTVGDILLKDELDSFATNSPNRFKVYYVLSQPTEVWNGGIGHVSKEMIQMHCPT 252
HLIYANVT DILLK+E+D+ AT PNRFKVYYVL+QP E W GGIG +SKEMIQ HCP
Sbjct: 183 HLIYANVTYEDILLKEEIDNLATTFPNRFKVYYVLNQPPEGWEGGIGFISKEMIQSHCPP 242
Query: 253 PAPDIQ 258
PA D+Q
Sbjct: 243 PAADVQ 248
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296085353|emb|CBI29085.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225449782|ref|XP_002271202.1| PREDICTED: NADH-cytochrome b5 reductase 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|55979111|gb|AAV69019.1| NADH:cytochrome b5 reductase [Vernicia fordii] gi|55979115|gb|AAV69021.1| NADH:cytochrome b5 reductase [Vernicia fordii] | Back alignment and taxonomy information |
|---|
| >gi|255573283|ref|XP_002527570.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] gi|223533062|gb|EEF34822.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225436003|ref|XP_002273225.1| PREDICTED: NADH-cytochrome b5 reductase 1 [Vitis vinifera] gi|296083963|emb|CBI24351.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356504288|ref|XP_003520929.1| PREDICTED: NADH-cytochrome b5 reductase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255637950|gb|ACU19291.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224110072|ref|XP_002315404.1| predicted protein [Populus trichocarpa] gi|222864444|gb|EEF01575.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449437668|ref|XP_004136613.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| TAIR|locus:2176001 | 281 | CBR "NADH:cytochrome B5 reduct | 0.856 | 0.786 | 0.714 | 1.3e-86 | |
| CGD|CAL0001574 | 294 | CBR1 [Candida albicans (taxid: | 0.844 | 0.741 | 0.474 | 1.8e-55 | |
| UNIPROTKB|Q59P03 | 294 | CBR1 "NADH-cytochrome b5 reduc | 0.844 | 0.741 | 0.474 | 1.8e-55 | |
| DICTYBASE|DDB_G0285399 | 286 | cyb5r1 "NADH-cytochrome b5 red | 0.813 | 0.734 | 0.490 | 7e-54 | |
| POMBASE|SPCC970.03 | 301 | SPCC970.03 "cytochrome b5 redu | 0.786 | 0.674 | 0.482 | 3.8e-53 | |
| ASPGD|ASPL0000000398 | 310 | AN6366 [Emericella nidulans (t | 0.829 | 0.690 | 0.475 | 8.3e-51 | |
| UNIPROTKB|A4R935 | 309 | CBR1 "NADH-cytochrome b5 reduc | 0.829 | 0.692 | 0.466 | 2.9e-48 | |
| TAIR|locus:2147680 | 328 | AT5G20080 "AT5G20080" [Arabido | 0.841 | 0.661 | 0.444 | 1.4e-46 | |
| SGD|S000001305 | 284 | CBR1 "Microsomal cytochrome b | 0.821 | 0.746 | 0.414 | 5.6e-45 | |
| ASPGD|ASPL0000017615 | 510 | AN3862 [Emericella nidulans (t | 0.813 | 0.411 | 0.419 | 2.4e-44 |
| TAIR|locus:2176001 CBR "NADH:cytochrome B5 reductase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 866 (309.9 bits), Expect = 1.3e-86, P = 1.3e-86
Identities = 158/221 (71%), Positives = 183/221 (82%)
Query: 38 YLCSIKKSRGSLDPENFKEFKLTKRTPISHNTAKFRFALPKSTSILGLPVGQHILCRGKD 97
+L S KK R LDPENFKEFKL KR +SHN AKF F LP STS+LGLP+GQHI CRGKD
Sbjct: 31 FLTSSKKRRVCLDPENFKEFKLVKRHQLSHNVAKFVFELPTSTSVLGLPIGQHISCRGKD 90
Query: 98 SEGNEVIRPYTPITLDSDIGYFELVVKMYPKGRMAHHFREMHEGEYLPVKGPKGRLKYKV 157
+G +VI+PYTP TLDSD+G FELV+KMYP+GRM+HHFREM G++L VKGPKGR KY+
Sbjct: 91 GQGEDVIKPYTPTTLDSDVGRFELVIKMYPQGRMSHHFREMRVGDHLAVKGPKGRFKYQP 150
Query: 158 GQARAFGMIAGGTGITPMFQLTRAILENPKDKTNVHLIYANVTVGDILLKDELDSFATNS 217
GQ RAFGM+AGG+GITPMFQ+ RAILENP DKT VHLIYANVT DILLK+EL+ TN
Sbjct: 151 GQFRAFGMLAGGSGITPMFQVARAILENPTDKTKVHLIYANVTYDDILLKEELEGLTTNY 210
Query: 218 PNRFKVYYVLSQPTEVWNGGIGHVSKEMIQMHCPTPAPDIQ 258
P +FK++YVL+QP EVW+GG+G VSKEMIQ HCP PA DIQ
Sbjct: 211 PEQFKIFYVLNQPPEVWDGGVGFVSKEMIQTHCPAPASDIQ 251
|
|
| CGD|CAL0001574 CBR1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59P03 CBR1 "NADH-cytochrome b5 reductase 1" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285399 cyb5r1 "NADH-cytochrome b5 reductase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC970.03 SPCC970.03 "cytochrome b5 reductase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000000398 AN6366 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4R935 CBR1 "NADH-cytochrome b5 reductase 1" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147680 AT5G20080 "AT5G20080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| SGD|S000001305 CBR1 "Microsomal cytochrome b reductase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000017615 AN3862 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| cd06183 | 234 | cd06183, cyt_b5_reduct_like, Cytochrome b5 reducta | 2e-97 | |
| PLN02252 | 888 | PLN02252, PLN02252, nitrate reductase [NADPH] | 6e-70 | |
| PTZ00319 | 300 | PTZ00319, PTZ00319, NADH-cytochrome B5 reductase; | 6e-62 | |
| PTZ00274 | 325 | PTZ00274, PTZ00274, cytochrome b5 reductase; Provi | 4e-36 | |
| pfam00970 | 99 | pfam00970, FAD_binding_6, Oxidoreductase FAD-bindi | 5e-36 | |
| PTZ00306 | 1167 | PTZ00306, PTZ00306, NADH-dependent fumarate reduct | 7e-29 | |
| cd00322 | 223 | cd00322, FNR_like, Ferredoxin reductase (FNR), an | 2e-28 | |
| COG0543 | 252 | COG0543, UbiB, 2-polyprenylphenol hydroxylase and | 2e-28 | |
| cd06215 | 231 | cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur bi | 3e-24 | |
| pfam00175 | 106 | pfam00175, NAD_binding_1, Oxidoreductase NAD-bindi | 7e-21 | |
| cd06214 | 241 | cd06214, PA_degradation_oxidoreductase_like, NAD(P | 4e-20 | |
| cd06217 | 235 | cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur bi | 4e-19 | |
| COG1018 | 266 | COG1018, Hmp, Flavodoxin reductases (ferredoxin-NA | 2e-16 | |
| cd06216 | 243 | cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur bi | 4e-14 | |
| cd06187 | 224 | cd06187, O2ase_reductase_like, The oxygenase reduc | 9e-14 | |
| cd06190 | 232 | cd06190, T4MO_e_transfer_like, Toluene-4-monoxygen | 1e-13 | |
| cd06196 | 218 | cd06196, FNR_like_1, Ferredoxin reductase-like pro | 2e-13 | |
| cd06184 | 247 | cd06184, flavohem_like_fad_nad_binding, FAD_NAD(P) | 3e-13 | |
| TIGR02160 | 352 | TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenas | 4e-13 | |
| cd06191 | 231 | cd06191, FNR_iron_sulfur_binding, Iron-sulfur bind | 2e-12 | |
| cd06189 | 224 | cd06189, flavin_oxioreductase, NAD(P)H dependent f | 4e-12 | |
| cd06212 | 232 | cd06212, monooxygenase_like, The oxygenase reducta | 6e-12 | |
| cd06211 | 238 | cd06211, phenol_2-monooxygenase_like, Phenol 2-mon | 5e-11 | |
| cd06221 | 253 | cd06221, sulfite_reductase_like, Anaerobic sulfite | 7e-11 | |
| cd06209 | 228 | cd06209, BenDO_FAD_NAD, Benzoate dioxygenase reduc | 2e-10 | |
| cd06213 | 227 | cd06213, oxygenase_e_transfer_subunit, The oxygena | 2e-09 | |
| cd06194 | 222 | cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulf | 3e-09 | |
| cd06210 | 236 | cd06210, MMO_FAD_NAD_binding, Methane monooxygenas | 7e-09 | |
| PRK08221 | 263 | PRK08221, PRK08221, anaerobic sulfite reductase su | 1e-06 | |
| cd06220 | 233 | cd06220, DHOD_e_trans_like2, FAD/NAD binding domai | 1e-06 | |
| cd06198 | 216 | cd06198, FNR_like_3, NAD(P) binding domain of ferr | 1e-06 | |
| PRK11872 | 340 | PRK11872, antC, anthranilate dioxygenase reductase | 3e-06 | |
| cd06197 | 220 | cd06197, FNR_like_2, FAD/NAD(P) binding domain of | 4e-06 | |
| cd06208 | 286 | cd06208, CYPOR_like_FNR, These ferredoxin reductas | 5e-06 | |
| COG4097 | 438 | COG4097, COG4097, Predicted ferric reductase [Inor | 5e-06 | |
| PRK13289 | 399 | PRK13289, PRK13289, bifunctional nitric oxide diox | 5e-06 | |
| cd06195 | 241 | cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase i | 1e-05 | |
| PRK07609 | 339 | PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucosee | 2e-05 | |
| PRK10684 | 332 | PRK10684, PRK10684, HCP oxidoreductase, NADH-depen | 2e-05 | |
| PRK08345 | 289 | PRK08345, PRK08345, cytochrome-c3 hydrogenase subu | 1e-04 | |
| cd06192 | 243 | cd06192, DHOD_e_trans_like, FAD/NAD binding domain | 2e-04 | |
| TIGR02911 | 261 | TIGR02911, sulfite_red_B, sulfite reductase, subun | 3e-04 | |
| PRK00054 | 250 | PRK00054, PRK00054, dihydroorotate dehydrogenase e | 0.001 | |
| cd06218 | 246 | cd06218, DHOD_e_trans, FAD/NAD binding domain in t | 0.002 |
| >gnl|CDD|99780 cd06183, cyt_b5_reduct_like, Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor | Back alignment and domain information |
|---|
Score = 284 bits (729), Expect = 2e-97
Identities = 104/201 (51%), Positives = 144/201 (71%), Gaps = 2/201 (0%)
Query: 57 FKLTKRTPISHNTAKFRFALPKSTSILGLPVGQHILCRGKDSEGNEVIRPYTPITLDSDI 116
FKL + ISH+T FRF LP +LGLPVGQH+ + D +G +V+RPYTPI+ D D
Sbjct: 1 FKLVSKEDISHDTRIFRFELPSPDQVLGLPVGQHVELKAPD-DGEQVVRPYTPISPDDDK 59
Query: 117 GYFELVVKMYPKGRMAHHFREMHEGEYLPVKGPKGRLKYKV-GQARAFGMIAGGTGITPM 175
GYF+L++K+YP G+M+ + + G+ + ++GP G+ +YK G+ + GMIAGGTGITPM
Sbjct: 60 GYFDLLIKIYPGGKMSQYLHSLKPGDTVEIRGPFGKFEYKPNGKVKHIGMIAGGTGITPM 119
Query: 176 FQLTRAILENPKDKTNVHLIYANVTVGDILLKDELDSFATNSPNRFKVYYVLSQPTEVWN 235
QL RAIL++P+DKT + L+YAN T DILL++ELD A P+RFKV+YVLS+P E W
Sbjct: 120 LQLIRAILKDPEDKTKISLLYANRTEEDILLREELDELAKKHPDRFKVHYVLSRPPEGWK 179
Query: 236 GGIGHVSKEMIQMHCPTPAPD 256
GG+G ++KEMI+ H P P +
Sbjct: 180 GGVGFITKEMIKEHLPPPPSE 200
|
Like ferredoxin reductases, these proteins have an N-terminal FAD binding subdomain and a C-terminal NADH binding subdomain, separated by a cleft, which accepts FAD. The NADH-binding moiety interacts with part of the FAD and resembles a Rossmann fold. However, NAD is bound differently than in canonical Rossmann fold proteins. Nitrate reductases, flavoproteins similar to pyridine nucleotide cytochrome reductases, catalyze the reduction of nitrate to nitrite. The enzyme can be divided into three functional fragments that bind the cofactors molybdopterin, heme-iron, and FAD/NADH. Length = 234 |
| >gnl|CDD|215141 PLN02252, PLN02252, nitrate reductase [NADPH] | Back alignment and domain information |
|---|
| >gnl|CDD|173521 PTZ00319, PTZ00319, NADH-cytochrome B5 reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140300 PTZ00274, PTZ00274, cytochrome b5 reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216220 pfam00970, FAD_binding_6, Oxidoreductase FAD-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|140327 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99778 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I | Back alignment and domain information |
|---|
| >gnl|CDD|223617 COG0543, UbiB, 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|99811 cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|215769 pfam00175, NAD_binding_1, Oxidoreductase NAD-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|99810 cd06214, PA_degradation_oxidoreductase_like, NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|99813 cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|223949 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|99812 cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|99784 cd06187, O2ase_reductase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant | Back alignment and domain information |
|---|
| >gnl|CDD|99787 cd06190, T4MO_e_transfer_like, Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system | Back alignment and domain information |
|---|
| >gnl|CDD|99793 cd06196, FNR_like_1, Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|99781 cd06184, flavohem_like_fad_nad_binding, FAD_NAD(P)H binding domain of flavohemoglobin | Back alignment and domain information |
|---|
| >gnl|CDD|131215 TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenase/reductase, PaaK subunit | Back alignment and domain information |
|---|
| >gnl|CDD|99788 cd06191, FNR_iron_sulfur_binding, Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|99786 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins | Back alignment and domain information |
|---|
| >gnl|CDD|99808 cd06212, monooxygenase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons | Back alignment and domain information |
|---|
| >gnl|CDD|99807 cd06211, phenol_2-monooxygenase_like, Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol | Back alignment and domain information |
|---|
| >gnl|CDD|99817 cd06221, sulfite_reductase_like, Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|99805 cd06209, BenDO_FAD_NAD, Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|99809 cd06213, oxygenase_e_transfer_subunit, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons | Back alignment and domain information |
|---|
| >gnl|CDD|99791 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|99806 cd06210, MMO_FAD_NAD_binding, Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol | Back alignment and domain information |
|---|
| >gnl|CDD|181300 PRK08221, PRK08221, anaerobic sulfite reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99816 cd06220, DHOD_e_trans_like2, FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|99795 cd06198, FNR_like_3, NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|183350 PRK11872, antC, anthranilate dioxygenase reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99794 cd06197, FNR_like_2, FAD/NAD(P) binding domain of ferredoxin reductase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|99804 cd06208, CYPOR_like_FNR, These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain | Back alignment and domain information |
|---|
| >gnl|CDD|226582 COG4097, COG4097, Predicted ferric reductase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237337 PRK13289, PRK13289, bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99792 cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin | Back alignment and domain information |
|---|
| >gnl|CDD|181058 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236735 PRK10684, PRK10684, HCP oxidoreductase, NADH-dependent; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236247 PRK08345, PRK08345, cytochrome-c3 hydrogenase subunit gamma; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99789 cd06192, DHOD_e_trans_like, FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|131957 TIGR02911, sulfite_red_B, sulfite reductase, subunit B | Back alignment and domain information |
|---|
| >gnl|CDD|234601 PRK00054, PRK00054, dihydroorotate dehydrogenase electron transfer subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|99814 cd06218, DHOD_e_trans, FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| KOG0534 | 286 | consensus NADH-cytochrome b-5 reductase [Coenzyme | 100.0 | |
| PTZ00274 | 325 | cytochrome b5 reductase; Provisional | 100.0 | |
| PTZ00319 | 300 | NADH-cytochrome B5 reductase; Provisional | 100.0 | |
| cd06217 | 235 | FNR_iron_sulfur_binding_3 Iron-sulfur binding ferr | 100.0 | |
| PRK11872 | 340 | antC anthranilate dioxygenase reductase; Provision | 100.0 | |
| cd06210 | 236 | MMO_FAD_NAD_binding Methane monooxygenase (MMO) re | 100.0 | |
| cd06183 | 234 | cyt_b5_reduct_like Cytochrome b5 reductase catalyz | 100.0 | |
| cd06215 | 231 | FNR_iron_sulfur_binding_1 Iron-sulfur binding ferr | 100.0 | |
| cd06211 | 238 | phenol_2-monooxygenase_like Phenol 2-monooxygenase | 100.0 | |
| PLN02252 | 888 | nitrate reductase [NADPH] | 100.0 | |
| cd06188 | 283 | NADH_quinone_reductase Na+-translocating NADH:quin | 100.0 | |
| PRK13289 | 399 | bifunctional nitric oxide dioxygenase/dihydropteri | 100.0 | |
| cd06189 | 224 | flavin_oxioreductase NAD(P)H dependent flavin oxid | 100.0 | |
| cd06184 | 247 | flavohem_like_fad_nad_binding FAD_NAD(P)H binding | 100.0 | |
| cd06191 | 231 | FNR_iron_sulfur_binding Iron-sulfur binding Ferred | 100.0 | |
| cd06216 | 243 | FNR_iron_sulfur_binding_2 Iron-sulfur binding ferr | 100.0 | |
| cd06209 | 228 | BenDO_FAD_NAD Benzoate dioxygenase reductase (BenD | 100.0 | |
| COG1018 | 266 | Hmp Flavodoxin reductases (ferredoxin-NADPH reduct | 100.0 | |
| TIGR02160 | 352 | PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, | 100.0 | |
| PRK07609 | 339 | CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat | 100.0 | |
| PRK10684 | 332 | HCP oxidoreductase, NADH-dependent; Provisional | 100.0 | |
| PRK08051 | 232 | fre FMN reductase; Validated | 100.0 | |
| PRK10926 | 248 | ferredoxin-NADP reductase; Provisional | 100.0 | |
| cd06195 | 241 | FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-c | 100.0 | |
| cd06212 | 232 | monooxygenase_like The oxygenase reductase FAD/NAD | 100.0 | |
| cd06214 | 241 | PA_degradation_oxidoreductase_like NAD(P) binding | 100.0 | |
| cd06213 | 227 | oxygenase_e_transfer_subunit The oxygenase reducta | 100.0 | |
| cd06187 | 224 | O2ase_reductase_like The oxygenase reductase FAD/N | 100.0 | |
| cd06190 | 232 | T4MO_e_transfer_like Toluene-4-monoxygenase electr | 100.0 | |
| PLN03116 | 307 | ferredoxin--NADP+ reductase; Provisional | 100.0 | |
| PRK08345 | 289 | cytochrome-c3 hydrogenase subunit gamma; Provision | 100.0 | |
| cd06208 | 286 | CYPOR_like_FNR These ferredoxin reductases are rel | 100.0 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 100.0 | |
| cd00322 | 223 | FNR_like Ferredoxin reductase (FNR), an FAD and NA | 100.0 | |
| PRK05464 | 409 | Na(+)-translocating NADH-quinone reductase subunit | 100.0 | |
| cd06196 | 218 | FNR_like_1 Ferredoxin reductase-like proteins cata | 100.0 | |
| PLN03115 | 367 | ferredoxin--NADP(+) reductase; Provisional | 100.0 | |
| TIGR01941 | 405 | nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo | 100.0 | |
| cd06221 | 253 | sulfite_reductase_like Anaerobic sulfite reductase | 100.0 | |
| cd06194 | 222 | FNR_N-term_Iron_sulfur_binding Iron-sulfur binding | 100.0 | |
| PRK08221 | 263 | anaerobic sulfite reductase subunit B; Provisional | 100.0 | |
| PRK05713 | 312 | hypothetical protein; Provisional | 100.0 | |
| COG0543 | 252 | UbiB 2-polyprenylphenol hydroxylase and related fl | 99.98 | |
| PRK05802 | 320 | hypothetical protein; Provisional | 99.97 | |
| TIGR02911 | 261 | sulfite_red_B sulfite reductase, subunit B. Member | 99.97 | |
| cd06201 | 289 | SiR_like2 Cytochrome p450- like alpha subunits of | 99.97 | |
| PRK06222 | 281 | ferredoxin-NADP(+) reductase subunit alpha; Review | 99.97 | |
| cd06218 | 246 | DHOD_e_trans FAD/NAD binding domain in the electro | 99.97 | |
| COG4097 | 438 | Predicted ferric reductase [Inorganic ion transpor | 99.97 | |
| cd06192 | 243 | DHOD_e_trans_like FAD/NAD binding domain (electron | 99.97 | |
| cd06182 | 267 | CYPOR_like NADPH cytochrome p450 reductase (CYPOR) | 99.97 | |
| TIGR03224 | 411 | benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p | 99.97 | |
| cd06198 | 216 | FNR_like_3 NAD(P) binding domain of ferredoxin red | 99.97 | |
| cd06219 | 248 | DHOD_e_trans_like1 FAD/NAD binding domain in the e | 99.97 | |
| PRK00054 | 250 | dihydroorotate dehydrogenase electron transfer sub | 99.97 | |
| cd06197 | 220 | FNR_like_2 FAD/NAD(P) binding domain of ferredoxin | 99.96 | |
| cd06200 | 245 | SiR_like1 Cytochrome p450- like alpha subunits of | 99.96 | |
| COG2871 | 410 | NqrF Na+-transporting NADH:ubiquinone oxidoreducta | 99.96 | |
| cd06185 | 211 | PDR_like Phthalate dioxygenase reductase (PDR) is | 99.96 | |
| cd06220 | 233 | DHOD_e_trans_like2 FAD/NAD binding domain in the e | 99.96 | |
| PLN02292 | 702 | ferric-chelate reductase | 99.95 | |
| cd06193 | 235 | siderophore_interacting Siderophore interacting pr | 99.95 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 99.94 | |
| PLN02631 | 699 | ferric-chelate reductase | 99.94 | |
| cd06186 | 210 | NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyz | 99.94 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 99.94 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 99.92 | |
| PLN02844 | 722 | oxidoreductase/ferric-chelate reductase | 99.92 | |
| cd06199 | 360 | SiR Cytochrome p450- like alpha subunits of E. col | 99.89 | |
| PF00970 | 99 | FAD_binding_6: Oxidoreductase FAD-binding domain; | 99.89 | |
| cd06207 | 382 | CyPoR_like NADPH cytochrome p450 reductase (CYPOR) | 99.89 | |
| cd06203 | 398 | methionine_synthase_red Human methionine synthase | 99.88 | |
| cd06206 | 384 | bifunctional_CYPOR These bifunctional proteins fus | 99.87 | |
| TIGR01931 | 597 | cysJ sulfite reductase [NADPH] flavoprotein, alpha | 99.87 | |
| PRK06214 | 530 | sulfite reductase; Provisional | 99.85 | |
| cd06204 | 416 | CYPOR NADPH cytochrome p450 reductase (CYPOR) serv | 99.84 | |
| cd06202 | 406 | Nitric_oxide_synthase The ferredoxin-reductase (FN | 99.84 | |
| PRK10953 | 600 | cysJ sulfite reductase subunit alpha; Provisional | 99.83 | |
| KOG0039 | 646 | consensus Ferric reductase, NADH/NADPH oxidase and | 99.77 | |
| KOG3378 | 385 | consensus Globins and related hemoproteins [Energy | 99.7 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 99.68 | |
| PF00175 | 109 | NAD_binding_1: Oxidoreductase NAD-binding domain ; | 99.66 | |
| COG0369 | 587 | CysJ Sulfite reductase, alpha subunit (flavoprotei | 99.65 | |
| KOG1158 | 645 | consensus NADP/FAD dependent oxidoreductase [Energ | 99.56 | |
| COG2375 | 265 | ViuB Siderophore-interacting protein [Inorganic io | 99.52 | |
| KOG1159 | 574 | consensus NADP-dependent flavoprotein reductase [E | 99.4 | |
| PF08021 | 117 | FAD_binding_9: Siderophore-interacting FAD-binding | 99.36 | |
| PF08022 | 105 | FAD_binding_8: FAD-binding domain; InterPro: IPR01 | 99.34 | |
| PF08030 | 156 | NAD_binding_6: Ferric reductase NAD binding domain | 99.02 | |
| COG1465 | 376 | Predicted alternative 3-dehydroquinate synthase [A | 85.38 | |
| PF00677 | 85 | Lum_binding: Lumazine binding domain; InterPro: IP | 82.7 | |
| PRK12446 | 352 | undecaprenyldiphospho-muramoylpentapeptide beta-N- | 80.68 |
| >KOG0534 consensus NADH-cytochrome b-5 reductase [Coenzyme transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7e-43 Score=296.37 Aligned_cols=212 Identities=48% Similarity=0.962 Sum_probs=201.4
Q ss_pred CCCCCCCCCCcEEEEEEEEEEeCCCEeEEEEECCCCCccCCCCCCcEEEEEEecCCCCeeeeeccccccCCCCCEEEEEE
Q 042788 44 KSRGSLDPENFKEFKLTKRTPISHNTAKFRFALPKSTSILGLPVGQHILCRGKDSEGNEVIRPYTPITLDSDIGYFELVV 123 (258)
Q Consensus 44 ~~~~~~~~~~~~~~~v~~~~~~~~~~~~l~l~~~~~~~~~~~~pGQ~v~l~~~~~~g~~~~R~ySi~s~~~~~~~l~~~V 123 (258)
..+...++..|.++++++++.+++|+..++|..|.....++...|||+.+.++ .+|....|||||.|.+.+.|.++|.|
T Consensus 41 ~~~~~~~~~~~~~~~l~~k~~~shdt~~f~f~lp~~~~~l~lp~g~hv~~~~~-i~g~~vvRpYTPvs~~~~~g~~~l~V 119 (286)
T KOG0534|consen 41 GKKTLVDPESYYPFRLIDKTELSHDTSLFRFVLPSADHVLGLPIGQHVVLKAP-IGGKLVVRPYTPVSLDDDKGYFDLVV 119 (286)
T ss_pred CcccccCCcceEEEEEEEEEeccCCceeEEEecCCchhccCcccceEEEEEec-CCCcEEEEecCCccCccccceEEEEE
Confidence 45667778789999999999999999999999998877899999999999999 88899999999999998889999999
Q ss_pred EEecCCccccccccCCCCCEEEEecccceeeecCCCCceEEEEEcCccHHHHHHHHHHHHhCCCCCCeEEEEEEeCCCcc
Q 042788 124 KMYPKGRMAHHFREMHEGEYLPVKGPKGRLKYKVGQARAFGMIAGGTGITPMFQLTRAILENPKDKTNVHLIYANVTVGD 203 (258)
Q Consensus 124 k~~~~G~~S~~L~~l~~Gd~v~v~gP~G~f~~~~~~~~~vvliagGtGItp~~sil~~l~~~~~~~~~v~l~~~~r~~~d 203 (258)
|.|++|.+|++|+++++||+|+++||.|.|.+++..++++.|||||||||||++++++++.+..+.+++.|+|+|++.+|
T Consensus 120 K~Y~~G~mS~~l~~LkiGd~ve~rGP~G~~~~~~~~~~~l~miAgGtGItPmlqii~~il~~~~d~tki~lly~N~te~D 199 (286)
T KOG0534|consen 120 KVYPKGKMSQHLDSLKIGDTVEFRGPIGEFKYDPQKAKHLGMIAGGTGITPMLQLIRAILKDPEDTTKISLLYANKTEDD 199 (286)
T ss_pred EeccCCcccHHHhcCCCCCEEEEecCccceEecCCCcceEEEEecccchhhHHHHHHHHhcCCCCCcEEEEEEecCCccc
Confidence 99999999999999999999999999999999888899999999999999999999999999878899999999999999
Q ss_pred cccHHHHHHHHhhCCCCeEEEEEEcCCCCCCCCccccccHHHHhhhCCCCCCC
Q 042788 204 ILLKDELDSFATNSPNRFKVYYVLSQPTEVWNGGIGHVSKEMIQMHCPTPAPD 256 (258)
Q Consensus 204 ~~~~~eL~~l~~~~~~~~~v~~~~s~~~~~~~~~~G~i~~~~l~~~~~~~~~~ 256 (258)
+++++||+++++++|.||++++++++++..|.+..|||++++++++++.+.++
T Consensus 200 ILlr~eL~~la~~~p~rf~~~y~v~~~~~~w~~~~g~It~~~i~~~l~~~~~~ 252 (286)
T KOG0534|consen 200 ILLREELEELASKYPERFKVWYVVDQPPEIWDGSVGFITKDLIKEHLPPPKEG 252 (286)
T ss_pred cchHHHHHHHHhhCcceEEEEEEEcCCcccccCccCccCHHHHHhhCCCCCCC
Confidence 99999999999999988999999999999999999999999999999988763
|
|
| >PTZ00274 cytochrome b5 reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00319 NADH-cytochrome B5 reductase; Provisional | Back alignment and domain information |
|---|
| >cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >PRK11872 antC anthranilate dioxygenase reductase; Provisional | Back alignment and domain information |
|---|
| >cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol | Back alignment and domain information |
|---|
| >cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor | Back alignment and domain information |
|---|
| >cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol | Back alignment and domain information |
|---|
| >PLN02252 nitrate reductase [NADPH] | Back alignment and domain information |
|---|
| >cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain | Back alignment and domain information |
|---|
| >PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional | Back alignment and domain information |
|---|
| >cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins | Back alignment and domain information |
|---|
| >cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin | Back alignment and domain information |
|---|
| >cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain | Back alignment and domain information |
|---|
| >COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit | Back alignment and domain information |
|---|
| >PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated | Back alignment and domain information |
|---|
| >PRK10684 HCP oxidoreductase, NADH-dependent; Provisional | Back alignment and domain information |
|---|
| >PRK08051 fre FMN reductase; Validated | Back alignment and domain information |
|---|
| >PRK10926 ferredoxin-NADP reductase; Provisional | Back alignment and domain information |
|---|
| >cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin | Back alignment and domain information |
|---|
| >cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons | Back alignment and domain information |
|---|
| >cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase | Back alignment and domain information |
|---|
| >cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons | Back alignment and domain information |
|---|
| >cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant | Back alignment and domain information |
|---|
| >cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system | Back alignment and domain information |
|---|
| >PLN03116 ferredoxin--NADP+ reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional | Back alignment and domain information |
|---|
| >cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I | Back alignment and domain information |
|---|
| >PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain | Back alignment and domain information |
|---|
| >PLN03115 ferredoxin--NADP(+) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit | Back alignment and domain information |
|---|
| >cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases | Back alignment and domain information |
|---|
| >cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain | Back alignment and domain information |
|---|
| >PRK08221 anaerobic sulfite reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK05713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05802 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02911 sulfite_red_B sulfite reductase, subunit B | Back alignment and domain information |
|---|
| >cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein | Back alignment and domain information |
|---|
| >cd06198 FNR_like_3 NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain | Back alignment and domain information |
|---|
| >cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed | Back alignment and domain information |
|---|
| >cd06197 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin reductase-like proteins | Back alignment and domain information |
|---|
| >cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster | Back alignment and domain information |
|---|
| >cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PLN02292 ferric-chelate reductase | Back alignment and domain information |
|---|
| >cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PLN02631 ferric-chelate reductase | Back alignment and domain information |
|---|
| >cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN02844 oxidoreductase/ferric-chelate reductase | Back alignment and domain information |
|---|
| >cd06199 SiR Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >PF00970 FAD_binding_6: Oxidoreductase FAD-binding domain; InterPro: IPR008333 These sequences contain an oxidoreductase FAD-binding domain | Back alignment and domain information |
|---|
| >cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate | Back alignment and domain information |
|---|
| >cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) | Back alignment and domain information |
|---|
| >TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component | Back alignment and domain information |
|---|
| >PRK06214 sulfite reductase; Provisional | Back alignment and domain information |
|---|
| >cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain | Back alignment and domain information |
|---|
| >PRK10953 cysJ sulfite reductase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG0039 consensus Ferric reductase, NADH/NADPH oxidase and related proteins [Inorganic ion transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG3378 consensus Globins and related hemoproteins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PF00175 NAD_binding_1: Oxidoreductase NAD-binding domain ; InterPro: IPR001433 Bacterial ferredoxin-NADP+ reductase may be bound to the thylakoid membrane or anchored to the thylakoid-bound phycobilisomes | Back alignment and domain information |
|---|
| >COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1158 consensus NADP/FAD dependent oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG2375 ViuB Siderophore-interacting protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1159 consensus NADP-dependent flavoprotein reductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF08021 FAD_binding_9: Siderophore-interacting FAD-binding domain; InterPro: IPR013113 Proteins in this entry are siderophore-interacting FAD-binding proteins | Back alignment and domain information |
|---|
| >PF08022 FAD_binding_8: FAD-binding domain; InterPro: IPR013112 This FAD binding domain is associated with ferric reductase NAD binding proteins and the heavy chain of Cytochrome b-245 | Back alignment and domain information |
|---|
| >PF08030 NAD_binding_6: Ferric reductase NAD binding domain; InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins | Back alignment and domain information |
|---|
| >COG1465 Predicted alternative 3-dehydroquinate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00677 Lum_binding: Lumazine binding domain; InterPro: IPR001783 The following proteins have been shown [, ] to be structurally and evolutionary related: Riboflavin synthase alpha chain (2 | Back alignment and domain information |
|---|
| >PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 258 | ||||
| 2eix_A | 243 | The Structure Of Physarum Polycephalum Cytochrome B | 2e-55 | ||
| 1umk_A | 275 | The Structure Of Human Erythrocyte Nadh-Cytochrome | 6e-45 | ||
| 1ndh_A | 272 | Crystal Structure Of Nadh-Cytochrome B5 Reductase F | 7e-43 | ||
| 1ib0_A | 274 | Crystal Structure Of Rat B5r In Complex With Fad An | 6e-42 | ||
| 1qx4_A | 274 | Structrue Of S127p Mutant Of Cytochrome B5 Reductas | 1e-41 | ||
| 1cne_A | 270 | Structural Studies On Corn Nitrate Reductase: Refin | 3e-39 | ||
| 1cnf_A | 270 | Structural Studies On Corn Nitrate Reductase: Refin | 3e-39 | ||
| 1tvc_A | 250 | Fad And Nadh Binding Domain Of Methane Monooxygenas | 9e-09 | ||
| 2b5o_A | 402 | Ferredoxin-nadp Reductase Length = 402 | 1e-04 | ||
| 1krh_A | 338 | X-Ray Stucture Of Benzoate Dioxygenase Reductase Le | 3e-04 | ||
| 2bmw_A | 304 | Ferredoxin: Nadp+reductase Mutant With Thr 155 Repl | 8e-04 | ||
| 1h42_A | 304 | Ferredoxin:nadp+ Reductase Mutant With Thr 155 Repl | 8e-04 | ||
| 2vyq_A | 304 | Ferredoxin:nadp Reductase Mutant With Thr 155 Repla | 8e-04 | ||
| 1ogi_A | 303 | Ferredoxin:nadp+ Reductase Mutant With Thr 155 Repl | 9e-04 |
| >pdb|2EIX|A Chain A, The Structure Of Physarum Polycephalum Cytochrome B5 Reductase Length = 243 | Back alignment and structure |
|
| >pdb|1UMK|A Chain A, The Structure Of Human Erythrocyte Nadh-Cytochrome B5 Reductase Length = 275 | Back alignment and structure |
| >pdb|1NDH|A Chain A, Crystal Structure Of Nadh-Cytochrome B5 Reductase From Pig Liver At 2.4 Angstroms Resolution Length = 272 | Back alignment and structure |
| >pdb|1IB0|A Chain A, Crystal Structure Of Rat B5r In Complex With Fad And Nad Length = 274 | Back alignment and structure |
| >pdb|1QX4|A Chain A, Structrue Of S127p Mutant Of Cytochrome B5 Reductase Length = 274 | Back alignment and structure |
| >pdb|1CNE|A Chain A, Structural Studies On Corn Nitrate Reductase: Refined Structure Of The Cytochrome B Reductase Fragment At 2.5 Angstroms, Its Adp Complex And An Active Site Mutant And Modeling Of The Cytochrome B Domain Length = 270 | Back alignment and structure |
| >pdb|1CNF|A Chain A, Structural Studies On Corn Nitrate Reductase: Refined Structure Of The Cytochrome B Reductase Fragment At 2.5 Angstroms, Its Adp Complex And An Active Site Mutant And Modeling Of The Cytochrome B Domain Length = 270 | Back alignment and structure |
| >pdb|1TVC|A Chain A, Fad And Nadh Binding Domain Of Methane Monooxygenase Reductase From Methylococcus Capsulatus (Bath) Length = 250 | Back alignment and structure |
| >pdb|2B5O|A Chain A, Ferredoxin-nadp Reductase Length = 402 | Back alignment and structure |
| >pdb|1KRH|A Chain A, X-Ray Stucture Of Benzoate Dioxygenase Reductase Length = 338 | Back alignment and structure |
| >pdb|2BMW|A Chain A, Ferredoxin: Nadp+reductase Mutant With Thr 155 Replaced By Gly, Ala 160 Replaced By Thr, Leu 263 Replaced By Pro, Arg 264 Replaced By Pro And Gly 265 Replaced By Pro (T155g- A160t-L263p-R264p-G265p) Length = 304 | Back alignment and structure |
| >pdb|1H42|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Thr 155 Replaced By Gly, Ala 160 Replaced By Thr And Leu 263 Replaced By Pro (T155g-A160t-L263p) Length = 304 | Back alignment and structure |
| >pdb|2VYQ|A Chain A, Ferredoxin:nadp Reductase Mutant With Thr 155 Replaced By Gly, Ala 160 Replaced By Thr, Leu 263 Replaced By Pro And Tyr 303 Replaced By Ser (T155g-A160t-L263p-Y303s) Length = 304 | Back alignment and structure |
| >pdb|1OGI|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Thr 155 Replaced By Gly And Ala 160 Replaced By Thr (T155g-A160t) Length = 303 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| 2eix_A | 243 | NADH-cytochrome B5 reductase; flavoprotein, FAD-bi | 1e-111 | |
| 1umk_A | 275 | B5R, NADH-cytochrome B5 reductase; flavoprotein, b | 4e-93 | |
| 2cnd_A | 270 | NADH-dependent nitrate reductase; nitrate assimila | 2e-88 | |
| 1tvc_A | 250 | Methane monooxygenase component C, methane monooxy | 6e-29 | |
| 1gvh_A | 396 | Flavohemoprotein; oxidoreductase, NADP, heme, flav | 3e-26 | |
| 1cqx_A | 403 | Flavohemoprotein; globin fold, six-stranded antipa | 2e-24 | |
| 1qfj_A | 232 | Protein (flavin reductase); riboflavin, ferredoxin | 3e-24 | |
| 1krh_A | 338 | Benzoate 1,2-dioxygenase reductase; alpha-beta, FA | 3e-23 | |
| 1fdr_A | 248 | Flavodoxin reductase; ferredoxin reductase, flavin | 9e-22 | |
| 2r6h_A | 290 | NADH:ubiquinone oxidoreductase, Na translocating, | 9e-21 | |
| 4eh1_A | 243 | Flavohemoprotein; structural genomics, niaid, nati | 1e-18 | |
| 2qdx_A | 257 | Ferredoxin reductase; oxidoreductase; HET: FAD; 1. | 5e-17 | |
| 4fk8_A | 271 | Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st | 8e-17 | |
| 2bgi_A | 272 | Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi | 2e-14 | |
| 1ep3_B | 262 | Dihydroorotate dehydrogenase B (PYRK subunit); het | 7e-10 | |
| 2pia_A | 321 | Phthalate dioxygenase reductase; HET: FMN; 2.00A { | 5e-09 | |
| 2gpj_A | 252 | Siderophore-interacting protein; structural genomi | 1e-06 | |
| 3lrx_A | 158 | Putative hydrogenase; alpha-beta protein, structur | 6e-06 | |
| 3lyu_A | 142 | Putative hydrogenase; the C-terminal has AN alpha- | 2e-04 | |
| 2bmw_A | 304 | Ferredoxin--NADP reductase; oxidoreductase, flavop | 7e-04 | |
| 3jqq_A | 316 | Ferredoxin NADP reductase; FAD, oxidoreductase; HE | 8e-04 |
| >2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} Length = 243 | Back alignment and structure |
|---|
Score = 320 bits (822), Expect = e-111
Identities = 101/215 (46%), Positives = 146/215 (67%), Gaps = 2/215 (0%)
Query: 44 KSRGSLDPENFKEFKLTKRTPISHNTAKFRFALPKSTSILGLPVGQHILCRGKDSEGNEV 103
K +L+P +K+F L ++ I+HNT FRF L ++GLP+GQH+ + +G E+
Sbjct: 1 KREPALNPNEYKKFMLREKQIINHNTRLFRFNLHHPEDVVGLPIGQHMSVKATV-DGKEI 59
Query: 104 IRPYTPITLDSDIGYFELVVKMYPKGRMAHHFREMHEGEYLPVKGPKGRLKYKVGQARAF 163
RPYTP++ D + GYF+L++K+Y KG+M+ + ++ G++L V+GPKG+ YK +
Sbjct: 60 YRPYTPVSSDDEKGYFDLIIKVYEKGQMSQYIDHLNPGDFLQVRGPKGQFDYKPNMVKEM 119
Query: 164 GMIAGGTGITPMFQLTRAILENPKDKTNVHLIYANVTVGDILLKDELDSFATNSPNRFKV 223
GMIAGGTGITPM Q+ RAI++NPK+KT ++LI+ANV DILL+ ELD A N FKV
Sbjct: 120 GMIAGGTGITPMLQVARAIIKNPKEKTIINLIFANVNEDDILLRTELDDMAKKYSN-FKV 178
Query: 224 YYVLSQPTEVWNGGIGHVSKEMIQMHCPTPAPDIQ 258
YYVL+ P W GG+G VS +MI+ H P+ DI+
Sbjct: 179 YYVLNNPPAGWTGGVGFVSADMIKQHFSPPSSDIK 213
|
| >1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* Length = 275 | Back alignment and structure |
|---|
| >2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* Length = 270 | Back alignment and structure |
|---|
| >1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Length = 250 | Back alignment and structure |
|---|
| >1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Length = 396 | Back alignment and structure |
|---|
| >1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Length = 403 | Back alignment and structure |
|---|
| >1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Length = 232 | Back alignment and structure |
|---|
| >1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 | Back alignment and structure |
|---|
| >1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* Length = 248 | Back alignment and structure |
|---|
| >2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} Length = 290 | Back alignment and structure |
|---|
| >4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor} Length = 243 | Back alignment and structure |
|---|
| >2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Length = 257 | Back alignment and structure |
|---|
| >4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* Length = 271 | Back alignment and structure |
|---|
| >2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Length = 272 | Back alignment and structure |
|---|
| >1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Length = 262 | Back alignment and structure |
|---|
| >2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 321 | Back alignment and structure |
|---|
| >2gpj_A Siderophore-interacting protein; structural genomics, joint for structural genomics, JCSG; HET: FAD; 2.20A {Shewanella putrefaciens} Length = 252 | Back alignment and structure |
|---|
| >3lrx_A Putative hydrogenase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.60A {Pyrococcus furiosus} Length = 158 | Back alignment and structure |
|---|
| >3lyu_A Putative hydrogenase; the C-terminal has AN alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.30A {Pyrococcus furiosus} Length = 142 | Back alignment and structure |
|---|
| >2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... Length = 304 | Back alignment and structure |
|---|
| >3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* Length = 316 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| 2eix_A | 243 | NADH-cytochrome B5 reductase; flavoprotein, FAD-bi | 100.0 | |
| 1umk_A | 275 | B5R, NADH-cytochrome B5 reductase; flavoprotein, b | 100.0 | |
| 2cnd_A | 270 | NADH-dependent nitrate reductase; nitrate assimila | 100.0 | |
| 1tvc_A | 250 | Methane monooxygenase component C, methane monooxy | 100.0 | |
| 2r6h_A | 290 | NADH:ubiquinone oxidoreductase, Na translocating, | 100.0 | |
| 1qfj_A | 232 | Protein (flavin reductase); riboflavin, ferredoxin | 100.0 | |
| 1fdr_A | 248 | Flavodoxin reductase; ferredoxin reductase, flavin | 100.0 | |
| 4eh1_A | 243 | Flavohemoprotein; structural genomics, niaid, nati | 100.0 | |
| 1cqx_A | 403 | Flavohemoprotein; globin fold, six-stranded antipa | 100.0 | |
| 1gvh_A | 396 | Flavohemoprotein; oxidoreductase, NADP, heme, flav | 100.0 | |
| 3lo8_A | 311 | Ferredoxin--NADP reductase; electron transport, ox | 100.0 | |
| 3vo2_A | 310 | Putative uncharacterized protein; rossmann fold, o | 100.0 | |
| 4g1v_A | 399 | Flavohemoglobin; three domains: globin fold, antip | 100.0 | |
| 1krh_A | 338 | Benzoate 1,2-dioxygenase reductase; alpha-beta, FA | 100.0 | |
| 3jqq_A | 316 | Ferredoxin NADP reductase; FAD, oxidoreductase; HE | 100.0 | |
| 2bgi_A | 272 | Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi | 100.0 | |
| 1fnb_A | 314 | Ferredoxin-NADP+ reductase; oxidoreductase (NADP+( | 100.0 | |
| 2qdx_A | 257 | Ferredoxin reductase; oxidoreductase; HET: FAD; 1. | 100.0 | |
| 4fk8_A | 271 | Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st | 100.0 | |
| 2b5o_A | 402 | FNR, ferredoxin--NADP reductase; complex with FAD, | 100.0 | |
| 1ep3_B | 262 | Dihydroorotate dehydrogenase B (PYRK subunit); het | 100.0 | |
| 2bmw_A | 304 | Ferredoxin--NADP reductase; oxidoreductase, flavop | 100.0 | |
| 2rc5_A | 314 | Ferredoxin-NADP reductase; FAD, oxidoreductase; HE | 100.0 | |
| 2pia_A | 321 | Phthalate dioxygenase reductase; HET: FMN; 2.00A { | 99.98 | |
| 2gpj_A | 252 | Siderophore-interacting protein; structural genomi | 99.95 | |
| 1ddg_A | 374 | Sulfite reductase (NADPH) flavoprotein alpha- comp | 99.93 | |
| 4dql_A | 393 | Bifunctional P-450/NADPH-P450 reductase; rossmann | 99.89 | |
| 1f20_A | 435 | Nitric-oxide synthase; nitric-xoide synthase, redu | 99.88 | |
| 2qtl_A | 539 | MSR;, methionine synthase reductase; alpha-beta-al | 99.88 | |
| 1tll_A | 688 | Nitric-oxide synthase, brain; reductase module, FM | 99.86 | |
| 3qfs_A | 458 | CPR, P450R, NADPH--cytochrome P450 reductase; flav | 99.85 | |
| 2bpo_A | 682 | CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- | 99.84 | |
| 3qe2_A | 618 | CPR, P450R, NADPH--cytochrome P450 reductase; cypo | 99.83 | |
| 3lrx_A | 158 | Putative hydrogenase; alpha-beta protein, structur | 99.74 | |
| 3lyu_A | 142 | Putative hydrogenase; the C-terminal has AN alpha- | 99.69 | |
| 3a1f_A | 186 | Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi | 99.68 | |
| 3s2u_A | 365 | UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape | 84.38 |
| >2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.1e-40 Score=278.47 Aligned_cols=207 Identities=47% Similarity=0.932 Sum_probs=186.3
Q ss_pred CCCCCCCCCcEEEEEEEEEEeCCCEeEEEEECCCCCccCCCCCCcEEEEEEecCCCCeeeeeccccccCCCCCEEEEEEE
Q 042788 45 SRGSLDPENFKEFKLTKRTPISHNTAKFRFALPKSTSILGLPVGQHILCRGKDSEGNEVIRPYTPITLDSDIGYFELVVK 124 (258)
Q Consensus 45 ~~~~~~~~~~~~~~v~~~~~~~~~~~~l~l~~~~~~~~~~~~pGQ~v~l~~~~~~g~~~~R~ySi~s~~~~~~~l~~~Vk 124 (258)
.++.+++..|++++|++++.+++++.+++|+.++......|+||||+.|+++ .+|....|+|||+|.+.+.+.++|+||
T Consensus 2 ~~~~l~~~~~~~~~v~~~~~~t~~~~~~~l~~~~~~~~~~~~pGq~v~l~~~-~~g~~~~R~ysi~s~~~~~~~~~l~vk 80 (243)
T 2eix_A 2 REPALNPNEYKKFMLREKQIINHNTRLFRFNLHHPEDVVGLPIGQHMSVKAT-VDGKEIYRPYTPVSSDDEKGYFDLIIK 80 (243)
T ss_dssp CCCSCCSSSCEEEEEEEEEEEETTEEEEEEECSSTTCCCCCCTTCEEEEEEE-ETTEEEEEEECCCSCTTCCSEEEEEEE
T ss_pred CcccCCCCceEEEEEEEEEEeCCCeEEEEEEcCCCCcccCcCCceEEEEEEe-eCCCEEEeeeeecCCCCCCCEEEEEEE
Confidence 4678889999999999999999999999999887544578999999999998 556678999999999877789999999
Q ss_pred EecCCccccccccCCCCCEEEEecccceeeecCCCCceEEEEEcCccHHHHHHHHHHHHhCCCCCCeEEEEEEeCCCccc
Q 042788 125 MYPKGRMAHHFREMHEGEYLPVKGPKGRLKYKVGQARAFGMIAGGTGITPMFQLTRAILENPKDKTNVHLIYANVTVGDI 204 (258)
Q Consensus 125 ~~~~G~~S~~L~~l~~Gd~v~v~gP~G~f~~~~~~~~~vvliagGtGItp~~sil~~l~~~~~~~~~v~l~~~~r~~~d~ 204 (258)
.+++|.+|+||+++++||+|.+.||+|.|.++.+..++++||||||||||++++++++..+.....+++++|++|+.+++
T Consensus 81 ~~~~G~~S~~l~~l~~Gd~v~v~gP~G~f~~~~~~~~~~vliagG~GiaP~~~~l~~l~~~~~~~~~v~l~~~~r~~~~~ 160 (243)
T 2eix_A 81 VYEKGQMSQYIDHLNPGDFLQVRGPKGQFDYKPNMVKEMGMIAGGTGITPMLQVARAIIKNPKEKTIINLIFANVNEDDI 160 (243)
T ss_dssp CCTTCHHHHHHHTCCTTCEEEEEEEECSCCCCTTSSSEEEEEEEGGGHHHHHHHHHHHHTCTTCCCEEEEEEEEEEGGGC
T ss_pred EcCCCCcchHhhcCCCCCEEEEECCeEEEEeCCCCCcEEEEEecCccHHHHHHHHHHHHhCCCCCcEEEEEEEcCCHHHh
Confidence 98889999999999999999999999998887655689999999999999999999998763345789999999999999
Q ss_pred ccHHHHHHHHhhCCCCeEEEEEEcCCCCCCCCccccccHHHHhhhCCCC
Q 042788 205 LLKDELDSFATNSPNRFKVYYVLSQPTEVWNGGIGHVSKEMIQMHCPTP 253 (258)
Q Consensus 205 ~~~~eL~~l~~~~~~~~~v~~~~s~~~~~~~~~~G~i~~~~l~~~~~~~ 253 (258)
+|.+||+++++++++ +++++++++++++|.+..|+++++.+++.++++
T Consensus 161 ~~~~el~~l~~~~~~-~~~~~~~s~~~~~~~g~~g~v~~~~l~~~~~~~ 208 (243)
T 2eix_A 161 LLRTELDDMAKKYSN-FKVYYVLNNPPAGWTGGVGFVSADMIKQHFSPP 208 (243)
T ss_dssp TTHHHHHHHHHHCTT-EEEEEEEEECCTTCCSEESSCCHHHHHHHSCCT
T ss_pred hHHHHHHHHHHHCCC-eEEEEEeCCCCccccCcCCccCHHHHHHhcCCC
Confidence 999999999998887 999999999888898899999988888887654
|
| >1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* | Back alignment and structure |
|---|
| >2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* | Back alignment and structure |
|---|
| >1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 | Back alignment and structure |
|---|
| >2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 | Back alignment and structure |
|---|
| >1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* | Back alignment and structure |
|---|
| >4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* | Back alignment and structure |
|---|
| >1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 | Back alignment and structure |
|---|
| >3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* | Back alignment and structure |
|---|
| >3vo2_A Putative uncharacterized protein; rossmann fold, oxidoreductase, FAD binding; HET: FAD; 1.39A {Zea mays} PDB: 3vo1_A* 1gaw_A* 1gaq_A* 1qg0_A* 4af6_A* 1qga_A* 1qfz_A* 1qfy_A* 4af7_A* 1sm4_A* 3mhp_A* 1fnb_A* 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 2xnc_A* | Back alignment and structure |
|---|
| >4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A* | Back alignment and structure |
|---|
| >1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* | Back alignment and structure |
|---|
| >2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* | Back alignment and structure |
|---|
| >1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A* | Back alignment and structure |
|---|
| >2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* | Back alignment and structure |
|---|
| >4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* | Back alignment and structure |
|---|
| >2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} | Back alignment and structure |
|---|
| >1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* | Back alignment and structure |
|---|
| >2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... | Back alignment and structure |
|---|
| >2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* | Back alignment and structure |
|---|
| >2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >2gpj_A Siderophore-interacting protein; structural genomics, joint for structural genomics, JCSG; HET: FAD; 2.20A {Shewanella putrefaciens} | Back alignment and structure |
|---|
| >1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* | Back alignment and structure |
|---|
| >4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* | Back alignment and structure |
|---|
| >1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 | Back alignment and structure |
|---|
| >2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* | Back alignment and structure |
|---|
| >1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 | Back alignment and structure |
|---|
| >3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A* | Back alignment and structure |
|---|
| >2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* | Back alignment and structure |
|---|
| >3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* | Back alignment and structure |
|---|
| >3lrx_A Putative hydrogenase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3lyu_A Putative hydrogenase; the C-terminal has AN alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.30A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 258 | ||||
| d2cnda1 | 114 | b.43.4.2 (A:11-124) Nitrate reductase core domain | 1e-20 | |
| d1umka1 | 124 | b.43.4.2 (A:30-153) cytochrome b5 reductase {Human | 4e-20 | |
| d1umka2 | 147 | c.25.1.1 (A:154-300) cytochrome b5 reductase {Huma | 1e-17 | |
| d1gvha2 | 107 | b.43.4.2 (A:147-253) Flavohemoglobin, central doma | 8e-17 | |
| d1cqxa2 | 111 | b.43.4.2 (A:151-261) Flavohemoglobin, central doma | 1e-14 | |
| d2cnda2 | 146 | c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea | 2e-13 | |
| d2piaa1 | 103 | b.43.4.2 (A:1-103) Phthalate dioxygenase reductase | 4e-13 | |
| d1jb9a2 | 154 | c.25.1.1 (A:163-316) Ferredoxin reductase (flavodo | 2e-11 | |
| d2bmwa2 | 162 | c.25.1.1 (A:142-303) Ferredoxin reductase (flavodo | 2e-11 | |
| d1krha1 | 100 | b.43.4.2 (A:106-205) Benzoate dioxygenase reductas | 4e-10 | |
| d1fnda2 | 160 | c.25.1.1 (A:155-314) Ferredoxin reductase (flavodo | 6e-10 | |
| d1ep3b2 | 160 | c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase | 1e-09 | |
| d1tvca1 | 109 | b.43.4.2 (A:2-110) Methane monooxygenase component | 2e-09 | |
| d1a8pa1 | 99 | b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxi | 6e-09 | |
| d1cqxa3 | 142 | c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal d | 1e-08 | |
| d1gvha3 | 143 | c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal d | 1e-07 | |
| d2piaa2 | 120 | c.25.1.2 (A:104-223) Phthalate dioxygenase reducta | 4e-07 | |
| d1ddga2 | 153 | c.25.1.4 (A:447-599) Sulfite reductase flavoprotei | 6e-07 | |
| d1ep3b1 | 101 | b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, | 9e-07 | |
| d1a8pa2 | 158 | c.25.1.1 (A:101-258) Ferredoxin reductase (flavodo | 2e-06 | |
| d1fdra2 | 148 | c.25.1.1 (A:101-248) Ferredoxin reductase (flavodo | 3e-06 | |
| d1qfja2 | 135 | c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase | 4e-06 | |
| d1krha2 | 133 | c.25.1.2 (A:206-338) Benzoate dioxygenase reductas | 5e-06 | |
| d1tvca2 | 141 | c.25.1.2 (A:111-251) Methane monooxygenase compone | 3e-05 | |
| d1f20a2 | 165 | c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synth | 5e-05 | |
| d1ja1a3 | 160 | c.25.1.4 (A:519-678) NADPH-cytochrome p450 reducta | 9e-04 |
| >d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]} Length = 114 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Reductase/isomerase/elongation factor common domain superfamily: Riboflavin synthase domain-like family: Ferredoxin reductase FAD-binding domain-like domain: Nitrate reductase core domain species: Corn (Zea mays) [TaxId: 4577]
Score = 82.1 bits (202), Expect = 1e-20
Identities = 36/110 (32%), Positives = 57/110 (51%), Gaps = 10/110 (9%)
Query: 56 EFKLTKRTPISHNTAKFRFALPKSTSILGLPVGQHILCRGKDSEGNEVIRPYTPITLDSD 115
+L + +S + FRF+LP +LGLP+G+HI +R YTP ++ +
Sbjct: 4 HCRLVAKKELSRDVRLFRFSLPSPDQVLGLPIGKHIFVCATIEGK-LCMRAYTPTSMVDE 62
Query: 116 IGYFELVVKMYPK---------GRMAHHFREMHEGEYLPVKGPKGRLKYK 156
IG+F+L+VK+Y K G M + + G Y+ VKGP G ++Y
Sbjct: 63 IGHFDLLVKVYFKNEHPKFPNGGLMTQYLDSLPVGSYIDVKGPLGHVEYT 112
|
| >d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
| >d1gvha2 b.43.4.2 (A:147-253) Flavohemoglobin, central domain {Escherichia coli [TaxId: 562]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cqxa2 b.43.4.2 (A:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]} Length = 111 | Back information, alignment and structure |
|---|
| >d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} Length = 146 | Back information, alignment and structure |
|---|
| >d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 103 | Back information, alignment and structure |
|---|
| >d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]} Length = 154 | Back information, alignment and structure |
|---|
| >d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} Length = 162 | Back information, alignment and structure |
|---|
| >d1krha1 b.43.4.2 (A:106-205) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Length = 100 | Back information, alignment and structure |
|---|
| >d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 160 | Back information, alignment and structure |
|---|
| >d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 160 | Back information, alignment and structure |
|---|
| >d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Length = 109 | Back information, alignment and structure |
|---|
| >d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} Length = 99 | Back information, alignment and structure |
|---|
| >d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Length = 142 | Back information, alignment and structure |
|---|
| >d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 143 | Back information, alignment and structure |
|---|
| >d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} Length = 153 | Back information, alignment and structure |
|---|
| >d1ep3b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 101 | Back information, alignment and structure |
|---|
| >d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]} Length = 158 | Back information, alignment and structure |
|---|
| >d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]} Length = 148 | Back information, alignment and structure |
|---|
| >d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Length = 135 | Back information, alignment and structure |
|---|
| >d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Length = 133 | Back information, alignment and structure |
|---|
| >d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Length = 141 | Back information, alignment and structure |
|---|
| >d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 165 | Back information, alignment and structure |
|---|
| >d1ja1a3 c.25.1.4 (A:519-678) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 160 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| d1fdra1 | 99 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.87 | |
| d1umka1 | 124 | cytochrome b5 reductase {Human (Homo sapiens) [Tax | 99.86 | |
| d2cnda1 | 114 | Nitrate reductase core domain {Corn (Zea mays) [Ta | 99.86 | |
| d1a8pa1 | 99 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.86 | |
| d1cqxa2 | 111 | Flavohemoglobin, central domain {Alcaligenes eutro | 99.85 | |
| d1gvha2 | 107 | Flavohemoglobin, central domain {Escherichia coli | 99.85 | |
| d1krha1 | 100 | Benzoate dioxygenase reductase {Acinetobacter sp. | 99.84 | |
| d1umka2 | 147 | cytochrome b5 reductase {Human (Homo sapiens) [Tax | 99.82 | |
| d2piaa1 | 103 | Phthalate dioxygenase reductase {Pseudomonas cepac | 99.82 | |
| d1tvca1 | 109 | Methane monooxygenase component C, MmoC {Methyloco | 99.82 | |
| d1ep3b1 | 101 | Dihydroorotate dehydrogenase B, PyrK subunit {Lact | 99.82 | |
| d1qfja1 | 97 | NAD(P)H:flavin oxidoreductase {Escherichia coli [T | 99.81 | |
| d1tvca2 | 141 | Methane monooxygenase component C, MmoC {Methyloco | 99.79 | |
| d1krha2 | 133 | Benzoate dioxygenase reductase {Acinetobacter sp. | 99.74 | |
| d1qfja2 | 135 | NAD(P)H:flavin oxidoreductase {Escherichia coli [T | 99.71 | |
| d2cnda2 | 146 | Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} | 99.7 | |
| d2bmwa1 | 133 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.69 | |
| d1fnda1 | 136 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.67 | |
| d1fnda2 | 160 | Ferredoxin reductase (flavodoxin reductase) {Spina | 99.58 | |
| d1gvha3 | 143 | Flavohemoglobin, C-terminal domain {Escherichia co | 99.58 | |
| d1fdra2 | 148 | Ferredoxin reductase (flavodoxin reductase) {Esche | 99.57 | |
| d1cqxa3 | 142 | Flavohemoglobin, C-terminal domain {Alcaligenes eu | 99.56 | |
| d1jb9a2 | 154 | Ferredoxin reductase (flavodoxin reductase) {Maize | 99.54 | |
| d1ja1a3 | 160 | NADPH-cytochrome p450 reductase {Rat (Rattus norve | 99.5 | |
| d2bmwa2 | 162 | Ferredoxin reductase (flavodoxin reductase) {Cyano | 99.5 | |
| d1ddga2 | 153 | Sulfite reductase flavoprotein {Escherichia coli [ | 99.48 | |
| d1jb9a1 | 157 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.44 | |
| d1f20a2 | 165 | Neuronal nitric-oxide synthase FAD/NADP+ domain {R | 99.39 | |
| d2piaa2 | 120 | Phthalate dioxygenase reductase {Pseudomonas cepac | 99.39 | |
| d1ep3b2 | 160 | Dihydroorotate dehydrogenase B, PyrK subunit {Lact | 99.26 | |
| d1a8pa2 | 158 | Ferredoxin reductase (flavodoxin reductase) {Azoto | 99.23 | |
| d1ddga1 | 221 | Sulfite reductase flavoprotein {Escherichia coli [ | 97.54 | |
| d1f20a1 | 270 | Neuronal nitric-oxide synthase FAD/NADP+ domain {R | 96.69 | |
| d1ja1a1 | 279 | NADPH-cytochrome p450 reductase {Rat (Rattus norve | 93.16 |
| >d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Reductase/isomerase/elongation factor common domain superfamily: Riboflavin synthase domain-like family: Ferredoxin reductase FAD-binding domain-like domain: Ferredoxin reductase (flavodoxin reductase) N-terminal domain species: Escherichia coli [TaxId: 562]
Probab=99.87 E-value=3.1e-22 Score=143.71 Aligned_cols=94 Identities=17% Similarity=0.263 Sum_probs=83.8
Q ss_pred CcEEEEEEEEEEeCCCEeEEEEECCCCCccCCCCCCcEEEEEEecCCCCeeeeeccccccCCCCCEEEEEEEEecCCccc
Q 042788 53 NFKEFKLTKRTPISHNTAKFRFALPKSTSILGLPVGQHILCRGKDSEGNEVIRPYTPITLDSDIGYFELVVKMYPKGRMA 132 (258)
Q Consensus 53 ~~~~~~v~~~~~~~~~~~~l~l~~~~~~~~~~~~pGQ~v~l~~~~~~g~~~~R~ySi~s~~~~~~~l~~~Vk~~~~G~~S 132 (258)
+|.+++|++++.++++++.++++.|. +.|+||||+.|.++ .+|....|+|||+|.|.+ +.++++||++++|.+|
T Consensus 2 ~w~~a~V~~v~~~t~~v~~l~~~~p~----~~f~pGQ~v~l~~~-~~g~~~~R~YSi~s~p~~-~~~~~~vk~~~~G~~S 75 (99)
T d1fdra1 2 DWVTGKVTKVQNWTDALFSLTVHAPV----LPFTAGQFTKLGLE-IDGERVQRAYSYVNSPDN-PDLEFYLVTVPDGKLS 75 (99)
T ss_dssp CEEEEEEEEEEECSSSEEEEEEECCC----CCCCTTCEEEEEEC-C---CEEEEEECCSCTTC-SSEEEEEECCTTCSSH
T ss_pred CcEEEEEEEEEEcCCCEEEEEEcCCC----CCCCCCcEEEeccC-CCCCcEEEEEccCCCCCC-ceeEEEEEEecCcHHH
Confidence 68999999999999999999999763 68999999999998 677788999999999876 7899999999999999
Q ss_pred cccccCCCCCEEEEecccce
Q 042788 133 HHFREMHEGEYLPVKGPKGR 152 (258)
Q Consensus 133 ~~L~~l~~Gd~v~v~gP~G~ 152 (258)
++|+++++||+|.++||.|.
T Consensus 76 ~~l~~lk~GD~v~v~gP~~g 95 (99)
T d1fdra1 76 PRLAALKPGDEVQVVSEAAG 95 (99)
T ss_dssp HHHHTCCTTCEEEEESSCBC
T ss_pred HHHhhCCCCCEEEECcCCCC
Confidence 99999999999999997665
|
| >d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1cqxa2 b.43.4.2 (A:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1gvha2 b.43.4.2 (A:147-253) Flavohemoglobin, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1krha1 b.43.4.2 (A:106-205) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} | Back information, alignment and structure |
|---|
| >d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} | Back information, alignment and structure |
|---|
| >d1ep3b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1qfja1 b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} | Back information, alignment and structure |
|---|
| >d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} | Back information, alignment and structure |
|---|
| >d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2bmwa1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1fnda1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ja1a3 c.25.1.4 (A:519-678) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ddga1 b.43.4.1 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f20a1 b.43.4.1 (A:963-1232) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ja1a1 b.43.4.1 (A:240-518) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|