Citrus Sinensis ID: 042793


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-----
MRDLGAETNDGIRFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYGDDETITHVIGIQFFTEANVDLGPVPGYPVKEFLKSSERQRSFFSGNRTFPIGDRNVCREVCGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPGGIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELSLVSK
ccccccccccccEEEECcccccccccccccHHHHHHHHHHHHcccEEcccccccccccccccEEEEEEEEECccccEEEEEEEEEECccccccccccccccccccccccccccccccccCEECccccccccccccccccccEEEEEEEccccccccccccccccccEEcccccccccEEEccccccccEEEEEEEccccccccccccEEEEEcccccEEEECcccccccccccCEEEEEccEEEEEccccccccccccEEEEEcccccccEEEEccccccccccccEEEEEcccEEEEEEcccccccccCEEEEEccccccCEECcccccccccccccEEEEECccEEEEEccccccccccccEEEEEccccccEEEEcccccccccccccEEEEEcccEEEEEcccccccccccccccEEEEEcccccCEEEEECccccccccccccccccccccCEEEEEEccEEEEEccccccccccccEEEEEcccccccEEEEcccccccccccccEEEEEcccEEEEEccccccccccccEEEEEcccc
********NDGIRFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYGDDETITHVIGIQFFTEANVDLGPVPGYPVKEFL**********SGNRTFPIGDRNVCREVCGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHVHV****PGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGSGMP******GIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELSLVSK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRDLGAETNDGIRFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYGDDETITHVIGIQFFTEANVDLGPVPGYPVKEFLKSSERQRSFFSGNRTFPIGDRNVCREVCGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPGGIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELSLVSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adagio protein 1 Component of E3 ubiquitin ligase complexes that plays a central role blue-light-dependent circadian cycles. Acts as a blue-light photoreceptor, due to the presence of FMN, that mediates light-regulated protein degradation of critical clock components by targeting them to the proteasome complex. The SCF(ADO1) E3 ubiquitin ligase complex is involved in the regulation of circadian clock-dependent processes including transition to flowering time, hypocotyl elongation, cotyledons and leaves movement rhythms. APRR1 and APRR5 seem to be substrates of the SCF(ADO1) complex.confidentQ94BT6
Adagio-like protein 1 Component of E3 ubiquitin ligase complexes that plays a central role blue-light-dependent circadian cycles. Acts as a blue-light photoreceptor, due to the presence of FMN, that mediates light-regulated protein degradation of critical clock components by targeting them to the proteasome complex.confidentQ5Z8K3
Putative adagio-like protein 2 Component of E3 ubiquitin ligase complexes that plays a central role blue-light-dependent circadian cycles. Acts as a blue-light photoreceptor, due to the presence of FMN, that mediates light-regulated protein degradation of critical clock components by targeting them to the proteasome complex.probableQ67UX0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZWA, chain A
Confidence level:very confident
Coverage over the Query: 226-438,450-544
View the alignment between query and template
View the model in PyMOL
Template: 4ASC, chain A
Confidence level:very confident
Coverage over the Query: 209-438,451-528
View the alignment between query and template
View the model in PyMOL
Template: 3EWK, chain A
Confidence level:very confident
Coverage over the Query: 1-153
View the alignment between query and template
View the model in PyMOL
Template: 1P22, chain A
Confidence level:confident
Coverage over the Query: 135-438,451-490
View the alignment between query and template
View the model in PyMOL