Citrus Sinensis ID: 042793

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-----
MRDLGAETNDGIRFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYGDDETITHVIGIQFFTEANVDLGPVPGYPVKEFLKSSERQRSFFSGNRTFPIGDRNVCREVCGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPGGIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELSLVSK
ccccccccccccEEEEEcccccccccccccHHHHHHHHHHHHcccEEcccccccccccccccEEEEEEEEEEccccEEEEEEEEEEEccccccccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEEEccccccccccccccccccEEcccccccccEEEccccccccEEEEEEEccccccccccccEEEEEcccccEEEEEcccccccccccEEEEEEccEEEEEccccccccccccEEEEEcccccccEEEEccccccccccccEEEEEcccEEEEEEcccccccccEEEEEEccccccEEEEcccccccccccccEEEEEEccEEEEEccccccccccccEEEEEccccccEEEEcccccccccccccEEEEEcccEEEEEcccccccccccccccEEEEEcccccEEEEEEEccccccccccccccccccccEEEEEEEccEEEEEccccccccccccEEEEEcccccccEEEEcccccccccccccEEEEEcccEEEEEccccccccccccEEEEEcccc
ccccccccccHHHHHHccccHHHcccccccHHHHHHHHHHHHcccEEEccHHcccccccccHHEEEEEEcccccccEEEEEEEEEEccccccccccccccEEEccccccccccccccccccccccccccccHEEHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEcccccEEcccccccEEEcccccEEEccccccccccccccEEEEEccEEEEEEcccccccccccEEEEEccccccEEEEEccccccccccccEEEEEcccEEEEEEccccccccccEEEEEcccccccEcccccccccccccccEEEEEcccEEEEEEcccccccccccEEEEEccccccEEEEcccccccccccccEEEEEcccEEEEEEccccccccccccccEEEEEccccccEEEEEccccccccccccccccccccccEEEEEEccEEEEEEcccccccccccEEEEEccccccEEEEEcccccccccccccEEEEEcccEEEEEEcccccccccccEEEEccccc
MRDLGAETNDGIRFlqcrgpfakrrhplvdssVVSEIRRCLEEGIEFQGELLnfrkdgsplmnrlrlspiygddetitHVIGIQFfteanvdlgpvpgypvkeflksserqrsffsgnrtfpigdrnvcrEVCGIFQLSDEVISLKILswlsprdiasvGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVletvpgakrlgwgRLARELTTLEAATWRKltvggtvepsrcnfsacavgnrvvlfggegvnmqpmndTFVLdlnssnpewqhvhvsspppgrwghtlscvngshlvvfggcgrqgllndvfvldldakpptwreisglapplprswhssctldgtklivsggcadsgvllsdtflldlsmekpvwreipvtwtppsrlghtlsvyggrkilmfgglaksgplrfrssdvftmdlseeepcwrcvtgsgmpgagnpggiappprldhvavslpggrilifggsvaglhsatqlylldpteekptwrilnvpgrpprfawghstcvvggtrtivlggqtgeEWMLSELHELSLVSK
mrdlgaetndgirflqcrgpfakrrhplvdssvVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYGDDETITHVIGIQFFTEANVDLGPVPGYPVKEFLKSSERQRSFfsgnrtfpigdrnVCREVCGIFQLSDEVISLKILswlsprdiasvGSVCRRFYeltknedlwRMVCQNAWgsettrvletvpgakrlgwgrlARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREIsglapplprswHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWreipvtwtppsrlgHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPGGIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLselhelslvsk
MRDLGAETNDGIRFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYGDDETITHVIGIQFFTEANVDLGPVPGYPVKEFLKSSERQRSFFSGNRTFPIGDRNVCREVCGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTgsgmpgagnpggiapppRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELSLVSK
**********GIRFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYGDDETITHVIGIQFFTEANVDLGPVPGYPVKEFLK*****RSFFSGNRTFPIGDRNVCREVCGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHVHV****PGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGS***************RLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSEL********
********NDGIRFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYGDDETITHVIGIQFFTEANVDLGPVP******************SGNRTFPIGDRNVCREVCGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHV*******GRWGHTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPV*WTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGSGMP******GIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELSLVSK
********NDGIRFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYGDDETITHVIGIQFFTEANVDLGPVPGYPVKEFLKSSERQRSFFSGNRTFPIGDRNVCREVCGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPGGIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELSLVSK
*******TNDGIRFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYGDDETITHVIGIQFFTEANVDLGPVPGYPVKEFL*********************NVCREVCGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPGGIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELSLV**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRDLGAETNDGIRFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYGDDETITHVIGIQFFTEANVDLGPVPGYPVKEFLKSSERQRSFFSGNRTFPIGDRNVCREVCGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPGGIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELSLVSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query545 2.2.26 [Sep-21-2011]
Q94BT6609 Adagio protein 1 OS=Arabi yes no 0.961 0.860 0.868 0.0
Q5Z8K3630 Adagio-like protein 1 OS= yes no 0.976 0.844 0.827 0.0
Q67UX0635 Putative adagio-like prot no no 0.968 0.831 0.787 0.0
Q8W420611 Adagio protein 2 OS=Arabi no no 0.959 0.855 0.769 0.0
Q2R2W1630 Adagio-like protein 3 OS= no no 0.952 0.823 0.700 0.0
Q9C9W9619 Adagio protein 3 OS=Arabi no no 0.955 0.841 0.684 0.0
Q9C8K7478 F-box/kelch-repeat protei no no 0.594 0.677 0.28 6e-26
Q7M3S9 943 RING finger protein B OS= no no 0.449 0.259 0.263 3e-16
Q9SHS7 1006 Serine/threonine-protein no no 0.471 0.255 0.311 3e-15
Q9SJF0 1018 Serine/threonine-protein no no 0.471 0.252 0.314 3e-15
>sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 Back     alignment and function desciption
 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/532 (86%), Positives = 493/532 (92%), Gaps = 8/532 (1%)

Query: 13  RFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYG 72
           RFLQCRGPFAKRRHPLVDS VVSEIR+C++EGIEFQGELLNFRKDGSPLMNRLRL+PIYG
Sbjct: 83  RFLQCRGPFAKRRHPLVDSMVVSEIRKCIDEGIEFQGELLNFRKDGSPLMNRLRLTPIYG 142

Query: 73  DDETITHVIGIQFFTEANVDLGPVPGYPVKEFLKSSERQRSFFSGNRTFPIGDRNVCREV 132
           DD+TITH+IGIQFF E ++DLGPV        L SS +++S          G+RNV R +
Sbjct: 143 DDDTITHIIGIQFFIETDIDLGPV--------LGSSTKEKSIDGIYSALAAGERNVSRGM 194

Query: 133 CGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVL 192
           CG+FQLSDEV+S+KILS L+PRD+ASV SVCRR Y LTKNEDLWR VCQNAWGSETTRVL
Sbjct: 195 CGLFQLSDEVVSMKILSRLTPRDVASVSSVCRRLYVLTKNEDLWRRVCQNAWGSETTRVL 254

Query: 193 ETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVN 252
           ETVPGAKRLGWGRLARELTTLEAA WRKL+VGG+VEPSRCNFSACAVGNRVVLFGGEGVN
Sbjct: 255 ETVPGAKRLGWGRLARELTTLEAAAWRKLSVGGSVEPSRCNFSACAVGNRVVLFGGEGVN 314

Query: 253 MQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVF 312
           MQPMNDTFVLDLNS  PEWQHV VSSPPPGRWGHTL+CVNGS+LVVFGGCG+QGLLNDVF
Sbjct: 315 MQPMNDTFVLDLNSDYPEWQHVKVSSPPPGRWGHTLTCVNGSNLVVFGGCGQQGLLNDVF 374

Query: 313 VLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSME 372
           VL+LDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLS+E
Sbjct: 375 VLNLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSIE 434

Query: 373 KPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCW 432
           KPVWREIP  WTPPSRLGHTLSVYGGRKILMFGGLAKSGPL+FRSSDVFTMDLSEEEPCW
Sbjct: 435 KPVWREIPAAWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLKFRSSDVFTMDLSEEEPCW 494

Query: 433 RCVTGSGMPGAGNPGGIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEK 492
           RCVTGSGMPGAGNPGG+APPPRLDHVAV+LPGGRILIFGGSVAGLHSA+QLYLLDPTE+K
Sbjct: 495 RCVTGSGMPGAGNPGGVAPPPRLDHVAVNLPGGRILIFGGSVAGLHSASQLYLLDPTEDK 554

Query: 493 PTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELSLVS 544
           PTWRILN+PGRPPRFAWGH TCVVGGTR IVLGGQTGEEWMLSELHELSL S
Sbjct: 555 PTWRILNIPGRPPRFAWGHGTCVVGGTRAIVLGGQTGEEWMLSELHELSLAS 606
Component of E3 ubiquitin ligase complexes that plays a central role blue-light-dependent circadian cycles. Acts as a blue-light photoreceptor, due to the presence of FMN, that mediates light-regulated protein degradation of critical clock components by targeting them to the proteasome complex. The SCF(ADO1) E3 ubiquitin ligase complex is involved in the regulation of circadian clock-dependent processes including transition to flowering time, hypocotyl elongation, cotyledons and leaves movement rhythms. APRR1 and APRR5 seem to be substrates of the SCF(ADO1) complex.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 Back     alignment and function description
>sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 Back     alignment and function description
>sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 Back     alignment and function description
>sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 Back     alignment and function description
>sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 Back     alignment and function description
>sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 Back     alignment and function description
>sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 Back     alignment and function description
>sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 Back     alignment and function description
>sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query545
327342206535 ztla [Populus tremula] 0.976 0.994 0.926 0.0
351727148617 clock-associated PAS protein ZEITLUPE 2 0.977 0.863 0.926 0.0
224142237613 predicted protein [Populus trichocarpa] 0.977 0.869 0.919 0.0
351726710617 PAS protein ZEITLUPE 1 [Glycine max] gi| 0.977 0.863 0.924 0.0
255585018613 hypothetical protein RCOM_0545900 [Ricin 0.977 0.869 0.917 0.0
224126117614 f-box family protein [Populus trichocarp 0.976 0.866 0.907 0.0
449461199611 PREDICTED: adagio protein 1-like [Cucumi 0.977 0.872 0.904 0.0
327342208535 ztlb [Populus tremula] 0.976 0.994 0.909 0.0
356556190611 PREDICTED: adagio protein 1-like [Glycin 0.976 0.870 0.909 0.0
449507050611 PREDICTED: LOW QUALITY PROTEIN: adagio p 0.977 0.872 0.902 0.0
>gi|327342206|gb|AEA50890.1| ztla [Populus tremula] Back     alignment and taxonomy information
 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/532 (92%), Positives = 513/532 (96%)

Query: 13  RFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYG 72
           RFLQCRGPFAKRRHPLVDS+VVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRL+PIYG
Sbjct: 1   RFLQCRGPFAKRRHPLVDSTVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLTPIYG 60

Query: 73  DDETITHVIGIQFFTEANVDLGPVPGYPVKEFLKSSERQRSFFSGNRTFPIGDRNVCREV 132
           +D+TITHVIGIQFFTEAN+DLGPVPGY VKE  K +++ RS FS  R  P+GDRNV R +
Sbjct: 61  EDDTITHVIGIQFFTEANIDLGPVPGYSVKESSKLADKFRSGFSTYRPIPVGDRNVSRGI 120

Query: 133 CGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVL 192
           CGI QLSDEV+SLKILS L+PRDIAS+GSVCR+ YELTKNEDLWRMVCQNAWGSETTR L
Sbjct: 121 CGILQLSDEVLSLKILSRLTPRDIASIGSVCRQLYELTKNEDLWRMVCQNAWGSETTRAL 180

Query: 193 ETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVN 252
           ETVPGAKRLGWGRLARELTTLEAATWRKLTVGG+VEPSRCNFSACAVGNRVVLFGGEGVN
Sbjct: 181 ETVPGAKRLGWGRLARELTTLEAATWRKLTVGGSVEPSRCNFSACAVGNRVVLFGGEGVN 240

Query: 253 MQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVF 312
           MQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVF
Sbjct: 241 MQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVF 300

Query: 313 VLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSME 372
           +LDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSME
Sbjct: 301 ILDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSME 360

Query: 373 KPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCW 432
           KP+WREIPV+WTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCW
Sbjct: 361 KPIWREIPVSWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCW 420

Query: 433 RCVTGSGMPGAGNPGGIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEK 492
           RCVTGSGMPGAGNP GIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSA+QLYLLDPT+EK
Sbjct: 421 RCVTGSGMPGAGNPSGIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSASQLYLLDPTDEK 480

Query: 493 PTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELSLVS 544
           PTWRILNVPGRPPRFAWGHSTCVVGGTR IVLGGQTGEEWMLSELHELSL S
Sbjct: 481 PTWRILNVPGRPPRFAWGHSTCVVGGTRAIVLGGQTGEEWMLSELHELSLGS 532

Source: Populus tremula

Species: Populus tremula

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351727148|ref|NP_001235871.1| clock-associated PAS protein ZEITLUPE 2 [Glycine max] gi|87138099|gb|ABD28286.1| clock-associated PAS protein ZEITLUPE 2 [Glycine max] Back     alignment and taxonomy information
>gi|224142237|ref|XP_002324465.1| predicted protein [Populus trichocarpa] gi|222865899|gb|EEF03030.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351726710|ref|NP_001235856.1| PAS protein ZEITLUPE 1 [Glycine max] gi|87138097|gb|ABD28285.1| PAS protein ZEITLUPE 1 [Glycine max] Back     alignment and taxonomy information
>gi|255585018|ref|XP_002533219.1| hypothetical protein RCOM_0545900 [Ricinus communis] gi|223526962|gb|EEF29159.1| hypothetical protein RCOM_0545900 [Ricinus communis] Back     alignment and taxonomy information
>gi|224126117|ref|XP_002329665.1| f-box family protein [Populus trichocarpa] gi|222870546|gb|EEF07677.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449461199|ref|XP_004148329.1| PREDICTED: adagio protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|327342208|gb|AEA50891.1| ztlb [Populus tremula] Back     alignment and taxonomy information
>gi|356556190|ref|XP_003546409.1| PREDICTED: adagio protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449507050|ref|XP_004162920.1| PREDICTED: LOW QUALITY PROTEIN: adagio protein 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query545
TAIR|locus:2172994626 ZTL "AT5G57360" [Arabidopsis t 0.943 0.821 0.840 1.4e-243
TAIR|locus:505006254611 LKP2 "AT2G18915" [Arabidopsis 0.959 0.855 0.755 8.8e-221
TAIR|locus:2200176619 FKF1 "AT1G68050" [Arabidopsis 0.955 0.841 0.674 2.6e-196
TAIR|locus:2033934478 AT1G51550 "AT1G51550" [Arabido 0.631 0.719 0.280 1.7e-28
TAIR|locus:2201776 1018 BSL2 "BRI1 suppressor 1 (BSU1) 0.471 0.252 0.3 3.9e-15
DICTYBASE|DDB_G0270750485 DDB_G0270750 "Kelch repeat-con 0.337 0.379 0.334 6e-15
TAIR|locus:2059610 1006 BSL3 "BRI1 suppressor 1 (BSU1) 0.471 0.255 0.296 8.2e-15
POMBASE|SPCC1223.06 1147 tea1 "cell end marker Tea1" [S 0.376 0.178 0.290 1.3e-14
DICTYBASE|DDB_G0280765 777 DDB_G0280765 "Kelch repeat-con 0.515 0.361 0.288 1.5e-14
TAIR|locus:2184352514 AT5G04420 [Arabidopsis thalian 0.422 0.447 0.289 1.1e-13
TAIR|locus:2172994 ZTL "AT5G57360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2347 (831.2 bits), Expect = 1.4e-243, P = 1.4e-243
 Identities = 439/522 (84%), Positives = 468/522 (89%)

Query:    13 RFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYG 72
             RFLQCRGPFAKRRHPLVDS VVSEIR+C++EGIEFQGELLNFRKDGSPLMNRLRL+PIYG
Sbjct:    83 RFLQCRGPFAKRRHPLVDSMVVSEIRKCIDEGIEFQGELLNFRKDGSPLMNRLRLTPIYG 142

Query:    73 DDETITHVIGIQFFTEANVDLGPVPGYPVKEFLKSSERQRSFFSGNRTFPIGDRNVCREV 132
             DD+TITH+IGIQFF E ++DLGPV G   KE  KS +     +S       G+RNV R +
Sbjct:   143 DDDTITHIIGIQFFIETDIDLGPVLGSSTKE--KSID---GIYSA---LAAGERNVSRGM 194

Query:   133 CGIFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVL 192
             CG+FQLSDEV+S+KILS L+PRD+ASV SVCRR Y LTKNEDLWR VCQNAWGSETTRVL
Sbjct:   195 CGLFQLSDEVVSMKILSRLTPRDVASVSSVCRRLYVLTKNEDLWRRVCQNAWGSETTRVL 254

Query:   193 ETVPGAKRLGWGRLARELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVN 252
             ETVPGAKRLGWGRLARELTTLEAA WRKL+VGG+VEPSRCNFSACAVGNRVVLFGGEGVN
Sbjct:   255 ETVPGAKRLGWGRLARELTTLEAAAWRKLSVGGSVEPSRCNFSACAVGNRVVLFGGEGVN 314

Query:   253 MQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGCGRQGLLNDVF 312
             MQPMNDTFVLDLNS  PEWQHV VSSPPPGRWGHTL+CVNGS+LVVFGGCG+QGLLNDVF
Sbjct:   315 MQPMNDTFVLDLNSDYPEWQHVKVSSPPPGRWGHTLTCVNGSNLVVFGGCGQQGLLNDVF 374

Query:   313 VLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSME 372
             VL+LDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLS+E
Sbjct:   375 VLNLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSIE 434

Query:   373 KPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCW 432
             KPVWREIP  WTPPSRLGHTLSVYGGRKILMFGGLAKSGPL+FRSSDVFTMDLSEEEPCW
Sbjct:   435 KPVWREIPAAWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLKFRSSDVFTMDLSEEEPCW 494

Query:   433 RCVTXXXXXXXXXXXXXXXXXRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEK 492
             RCVT                 RLDHVAV+LPGGRILIFGGSVAGLHSA+QLYLLDPTE+K
Sbjct:   495 RCVTGSGMPGAGNPGGVAPPPRLDHVAVNLPGGRILIFGGSVAGLHSASQLYLLDPTEDK 554

Query:   493 PTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWML 534
             PTWRILN+PGRPPRFAWGH TCVVGGTR IVLGGQTGEEWML
Sbjct:   555 PTWRILNIPGRPPRFAWGHGTCVVGGTRAIVLGGQTGEEWML 596
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0004871 "signal transducer activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA;TAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0007623 "circadian rhythm" evidence=ISS;IMP;TAS
GO:0043153 "entrainment of circadian clock by photoperiod" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0009908 "flower development" evidence=IMP
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0010498 "proteasomal protein catabolic process" evidence=IMP
GO:0031146 "SCF-dependent proteasomal ubiquitin-dependent protein catabolic process" evidence=IC
GO:0019005 "SCF ubiquitin ligase complex" evidence=IPI
GO:0010114 "response to red light" evidence=IMP
GO:0042752 "regulation of circadian rhythm" evidence=RCA;IMP
GO:0009882 "blue light photoreceptor activity" evidence=IDA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0009639 "response to red or far red light" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0044265 "cellular macromolecule catabolic process" evidence=RCA
TAIR|locus:505006254 LKP2 "AT2G18915" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200176 FKF1 "AT1G68050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033934 AT1G51550 "AT1G51550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201776 BSL2 "BRI1 suppressor 1 (BSU1)-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2059610 BSL3 "BRI1 suppressor 1 (BSU1)-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPCC1223.06 tea1 "cell end marker Tea1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280765 DDB_G0280765 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2184352 AT5G04420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94BT6ADO1_ARATHNo assigned EC number0.86840.96140.8604yesno
Q5Z8K3ADO1_ORYSJNo assigned EC number0.82770.97610.8444yesno
Q2R2W1ADO3_ORYSJNo assigned EC number0.70010.95220.8238nono
Q8W420ADO2_ARATHNo assigned EC number0.76960.95960.8559nono
Q67UX0ADO2_ORYSJNo assigned EC number0.78710.96880.8314nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query545
pfam1293747 pfam12937, F-box-like, F-box-like 4e-10
PRK13559361 PRK13559, PRK13559, hypothetical protein; Provisio 6e-10
PRK13558665 PRK13558, PRK13558, bacterio-opsin activator; Prov 1e-09
pfam13426101 pfam13426, PAS_9, PAS domain 7e-09
PRK13557540 PRK13557, PRK13557, histidine kinase; Provisional 3e-07
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 2e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 2e-06
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 3e-06
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 4e-06
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 6e-06
pfam0064648 pfam00646, F-box, F-box domain 8e-06
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 3e-05
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 1e-04
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 5e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 0.001
pfam0764648 pfam07646, Kelch_2, Kelch motif 0.001
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 0.002
pfam1396450 pfam13964, Kelch_6, Kelch motif 0.002
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 0.003
pfam0134446 pfam01344, Kelch_1, Kelch motif 0.003
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information 
 Score = 54.8 bits (133), Expect = 4e-10
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 135 IFQLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQN 182
           +  L DE++ L+I S+L PRD+  +  VCRR+ EL  ++ LWR +C  
Sbjct: 1   LSDLPDEIL-LQIFSYLDPRDLLRLALVCRRWRELASDDSLWRRLCLR 47

This is an F-box-like family. Length = 47
>gnl|CDD|237427 PRK13559, PRK13559, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237426 PRK13558, PRK13558, bacterio-opsin activator; Provisional Back     alignment and domain information
>gnl|CDD|222120 pfam13426, PAS_9, PAS domain Back     alignment and domain information
>gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 545
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 100.0
KOG1230 521 consensus Protein containing repeated kelch motifs 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
KOG1230 521 consensus Protein containing repeated kelch motifs 100.0
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.98
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.98
PHA02790480 Kelch-like protein; Provisional 99.97
PHA02790480 Kelch-like protein; Provisional 99.96
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.95
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.88
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.81
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.58
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.4
PF1396450 Kelch_6: Kelch motif 99.16
PF1396450 Kelch_6: Kelch motif 99.14
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 99.0
PF1341549 Kelch_3: Galactose oxidase, central domain 98.96
PLN02772 398 guanylate kinase 98.95
PF1341549 Kelch_3: Galactose oxidase, central domain 98.92
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.88
PLN02772398 guanylate kinase 98.87
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.82
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.8
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.8
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.78
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.77
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.74
PF1385442 Kelch_5: Kelch motif 98.73
PF1385442 Kelch_5: Kelch motif 98.64
smart0061247 Kelch Kelch domain. 98.62
PRK13559361 hypothetical protein; Provisional 98.59
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.49
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 98.45
PF03089 337 RAG2: Recombination activating protein 2; InterPro 98.41
smart0061247 Kelch Kelch domain. 98.37
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 98.29
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.29
PRK13558665 bacterio-opsin activator; Provisional 98.25
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 98.24
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.19
PRK09776 1092 putative diguanylate cyclase; Provisional 98.16
PRK13560807 hypothetical protein; Provisional 98.09
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 98.08
PRK13557540 histidine kinase; Provisional 98.05
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.01
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.0
smart0025641 FBOX A Receptor for Ubiquitination Targets. 97.99
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.99
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 97.88
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 97.87
PRK13560 807 hypothetical protein; Provisional 97.86
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.84
PRK09776 1092 putative diguanylate cyclase; Provisional 97.83
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 97.74
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.74
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.74
PRK11091779 aerobic respiration control sensor protein ArcB; P 97.68
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.67
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 97.66
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.31
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 97.21
PRK11359799 cyclic-di-GMP phosphodiesterase; Provisional 97.0
PRK10060663 RNase II stability modulator; Provisional 96.92
KOG2997366 consensus F-box protein FBX9 [General function pre 96.91
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.88
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.87
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 96.71
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 96.68
PF12768281 Rax2: Cortical protein marker for cell polarity 96.61
smart0008643 PAC Motif C-terminal to PAS motifs (likely to cont 96.57
PF12768281 Rax2: Cortical protein marker for cell polarity 96.57
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 96.57
PF13596106 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. 96.53
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 96.5
PRK13684334 Ycf48-like protein; Provisional 96.27
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.2
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.18
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.02
COG1520370 FOG: WD40-like repeat [Function unknown] 95.87
PRK13684334 Ycf48-like protein; Provisional 95.81
PLN00033398 photosystem II stability/assembly factor; Provisio 95.78
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.54
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.36
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.15
KOG2055514 consensus WD40 repeat protein [General function pr 94.99
PRK11028330 6-phosphogluconolactonase; Provisional 94.72
PRK11360607 sensory histidine kinase AtoS; Provisional 94.5
KOG0310 487 consensus Conserved WD40 repeat-containing protein 94.3
KOG3926332 consensus F-box proteins [Amino acid transport and 94.19
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.16
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 94.02
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 93.75
KOG2055514 consensus WD40 repeat protein [General function pr 92.89
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 92.2
PF13088275 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 91.89
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 91.86
PRK05137435 tolB translocation protein TolB; Provisional 91.67
PF12860115 PAS_7: PAS fold 91.12
KOG1229775 consensus 3'5'-cyclic nucleotide phosphodiesterase 90.75
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 90.26
PRK11028330 6-phosphogluconolactonase; Provisional 90.21
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 89.98
PLN00033398 photosystem II stability/assembly factor; Provisio 89.62
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 89.16
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 88.52
COG1520370 FOG: WD40-like repeat [Function unknown] 88.46
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 87.85
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 87.43
PF13088275 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 87.38
PRK04922433 tolB translocation protein TolB; Provisional 86.57
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 86.3
PRK04043419 tolB translocation protein TolB; Provisional 86.28
PF07310137 PAS_5: PAS domain; InterPro: IPR009922 This family 86.2
PRK00178430 tolB translocation protein TolB; Provisional 85.28
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 84.87
COG2461409 Uncharacterized conserved protein [Function unknow 84.76
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 84.57
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 84.44
KOG2048 691 consensus WD40 repeat protein [General function pr 84.36
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 84.29
KOG4649 354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 81.35
PRK04792448 tolB translocation protein TolB; Provisional 81.08
KOG2048691 consensus WD40 repeat protein [General function pr 80.99
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 80.75
PRK04792448 tolB translocation protein TolB; Provisional 80.16
>PLN02153 epithiospecifier protein Back     alignment and domain information 
Probab=100.00  E-value=5.5e-42  Score=337.86  Aligned_cols=308  Identities=25%  Similarity=0.391  Sum_probs=236.9

Q ss_pred             ccCCcEEeccC-CCCCCCCCceeeEEECCEEEEEcCCCCC-CCccCceEEEeCCCCCCceEEeccCC-CCCC-ccceeEE
Q 042793          214 EAATWRKLTVG-GTVEPSRCNFSACAVGNRVVLFGGEGVN-MQPMNDTFVLDLNSSNPEWQHVHVSS-PPPG-RWGHTLS  289 (545)
Q Consensus       214 ~~~~W~~~~~~-~~~p~~r~~~~~~~~~~~lyv~GG~~~~-~~~~~~~~~~d~~t~~~~W~~~~~~~-~~~~-r~~~~~~  289 (545)
                      ....|..++.. +..|.+|.+|++++++++|||+||.... ....+++|+||+.++  +|+.++... .|.. +.+|+++
T Consensus         5 ~~~~W~~~~~~~~~~P~pR~~h~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~~~--~W~~~~~~~~~p~~~~~~~~~~   82 (341)
T PLN02153          5 LQGGWIKVEQKGGKGPGPRCSHGIAVVGDKLYSFGGELKPNEHIDKDLYVFDFNTH--TWSIAPANGDVPRISCLGVRMV   82 (341)
T ss_pred             cCCeEEEecCCCCCCCCCCCcceEEEECCEEEEECCccCCCCceeCcEEEEECCCC--EEEEcCccCCCCCCccCceEEE
Confidence            45679988653 4578899999999999999999998543 334689999999998  999876321 2322 3467777


Q ss_pred             EEcCCEEEEEcCCCCCcccCcEEEEecCCCCCceEeccCCC---CCCCCccceEEEEcCCEEEEEcCCCCCC-----Ccc
Q 042793          290 CVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLA---PPLPRSWHSSCTLDGTKLIVSGGCADSG-----VLL  361 (545)
Q Consensus       290 ~~~~~~iyv~GG~~~~~~~~~~~~yd~~t~~~~W~~~~~~~---~~~~r~~~~~~~~~~~~iyv~GG~~~~~-----~~~  361 (545)
                      ++ +++||||||......++++++||+.++  +|+.++++.   .|.+|..|++++. +++|||+||.+..+     ..+
T Consensus        83 ~~-~~~iyv~GG~~~~~~~~~v~~yd~~t~--~W~~~~~~~~~~~p~~R~~~~~~~~-~~~iyv~GG~~~~~~~~~~~~~  158 (341)
T PLN02153         83 AV-GTKLYIFGGRDEKREFSDFYSYDTVKN--EWTFLTKLDEEGGPEARTFHSMASD-ENHVYVFGGVSKGGLMKTPERF  158 (341)
T ss_pred             EE-CCEEEEECCCCCCCccCcEEEEECCCC--EEEEeccCCCCCCCCCceeeEEEEE-CCEEEEECCccCCCccCCCccc
Confidence            77 459999999887767889999999999  999987652   3788999998887 45999999986432     245


Q ss_pred             CcEEEEecCCCCCceEEecCCC-CCCCCCCcEEEEECCcEEEEEcccCCC----CCCccccCcEEEEeCCCCCCceEEee
Q 042793          362 SDTFLLDLSMEKPVWREIPVTW-TPPSRLGHTLSVYGGRKILMFGGLAKS----GPLRFRSSDVFTMDLSEEEPCWRCVT  436 (545)
Q Consensus       362 ~~~~~~d~~~~~~~W~~~~~~~-~p~~r~~~~~~~~~~~~lyi~GG~~~~----~~~~~~~~~i~~~d~~~~~~~W~~v~  436 (545)
                      +++++||+.  +++|+.++... .|.+|.+|+++++++ +||++||....    +......++++.||+.  +++|+++.
T Consensus       159 ~~v~~yd~~--~~~W~~l~~~~~~~~~r~~~~~~~~~~-~iyv~GG~~~~~~~gG~~~~~~~~v~~yd~~--~~~W~~~~  233 (341)
T PLN02153        159 RTIEAYNIA--DGKWVQLPDPGENFEKRGGAGFAVVQG-KIWVVYGFATSILPGGKSDYESNAVQFFDPA--SGKWTEVE  233 (341)
T ss_pred             ceEEEEECC--CCeEeeCCCCCCCCCCCCcceEEEECC-eEEEEeccccccccCCccceecCceEEEEcC--CCcEEecc
Confidence            789999954  66999987632 457899999998987 99999987531    1111125789999999  89999997


Q ss_pred             cCCCCCCCCCCCCCCCCCcceEEEEecCCEEEEEcCcCC--------CCCCCCceEEEcCCCCCCceEEeccCCCC--CC
Q 042793          437 GSGMPGAGNPGGIAPPPRLDHVAVSLPGGRILIFGGSVA--------GLHSATQLYLLDPTEEKPTWRILNVPGRP--PR  506 (545)
Q Consensus       437 ~~~~~~~~~~~g~~p~~r~~~~~~~~~~~~l~v~GG~~~--------~~~~~~~v~~~d~~~~~~~W~~~~~~~~~--p~  506 (545)
                      ..         +..|.+|..|+++++ +++||||||...        .....+++|+||++  +.+|+.+...+.+  |.
T Consensus       234 ~~---------g~~P~~r~~~~~~~~-~~~iyv~GG~~~~~~~~~~~~~~~~n~v~~~d~~--~~~W~~~~~~~~~~~pr  301 (341)
T PLN02153        234 TT---------GAKPSARSVFAHAVV-GKYIIIFGGEVWPDLKGHLGPGTLSNEGYALDTE--TLVWEKLGECGEPAMPR  301 (341)
T ss_pred             cc---------CCCCCCcceeeeEEE-CCEEEEECcccCCccccccccccccccEEEEEcC--ccEEEeccCCCCCCCCC
Confidence            65         556889998888877 899999999642        22346799999996  7899999754443  44


Q ss_pred             CCCCceeEEeC-CeeEEEEcCCCCcccccccceeeeecc
Q 042793          507 FAWGHSTCVVG-GTRTIVLGGQTGEEWMLSELHELSLVS  544 (545)
Q Consensus       507 ~r~~~~~~~~~-~~~l~i~GG~~~~~~~~~~~~~l~l~~  544 (545)
                      .+..++++.+. +++||||||.+...+.++|+|+|++.+
T Consensus       302 ~~~~~~~~~v~~~~~~~~~gG~~~~~~~~~~~~~~~~~~  340 (341)
T PLN02153        302 GWTAYTTATVYGKNGLLMHGGKLPTNERTDDLYFYAVNS  340 (341)
T ss_pred             ccccccccccCCcceEEEEcCcCCCCccccceEEEeccc
Confidence            45544555544 468999999988767889999999865

>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3926 consensus F-box proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF13088 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 1VCU_B 2F25_B 1SO7_A 2F29_A 1SNT_A 2F13_A 2F28_A 2F27_A Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12860 PAS_7: PAS fold Back     alignment and domain information
>KOG1229 consensus 3'5'-cyclic nucleotide phosphodiesterases [Signal transduction mechanisms] Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13088 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 1VCU_B 2F25_B 1SO7_A 2F29_A 1SNT_A 2F13_A 2F28_A 2F27_A Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF07310 PAS_5: PAS domain; InterPro: IPR009922 This family contains a number of hypothetical bacterial proteins of unknown function approximately 200 residues long Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG2461 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query545
2z6d_A130 Crystal Structure Of Lov1 Domain Of Phototropin2 Fr 6e-07
1n9l_A109 Crystal Structure Of The Phot-lov1 Domain From Chla 1e-04
3p7n_A258 Crystal Structure Of Light Activated Transcription 2e-04
2z6c_A129 Crystal Structure Of Lov1 Domain Of Phototropin1 Fr 3e-04
3sw1_A162 Structure Of A Full-Length Bacterial Lov Protein Le 4e-04
3is2_B154 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic 6e-04
3is2_A154 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic 6e-04
3hjk_A154 2.0 Angstrom Structure Of The Ile74val Variant Of V 6e-04
3hji_A154 1.8 Angstrom Crystal Structure Of The I74v:i85v Var 6e-04
>pdb|2Z6D|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin2 From Arabidopsis Thaliana Length = 130 Back     alignment and structure 
Iteration: 1

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 9/72 (12%)
Query: 13  RFLQCRGPFAKRRHPLVDSSVVSEIRRCLEEGIEFQGELLNFRKDGSPLMNRLRLSPIYG 72
           RFLQ          P  D + V++IR C++ G  + G LLN++KDG+P  N L ++PI  
Sbjct: 55  RFLQ---------GPDTDKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFWNLLTVTPIKD 105
Query: 73  DDETITHVIGIQ 84
           D       IG+Q
Sbjct: 106 DQGNTIKFIGMQ 117
>pdb|1N9L|A Chain A, Crystal Structure Of The Phot-lov1 Domain From Chlamydomonas Reinhardtii In The Dark State. Length = 109 Back     alignment and structure
>pdb|3P7N|A Chain A, Crystal Structure Of Light Activated Transcription Factor El222 From Erythrobacter Litoralis Length = 258 Back     alignment and structure
>pdb|2Z6C|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin1 From Arabidopsis Thaliana Length = 129 Back     alignment and structure
>pdb|3SW1|A Chain A, Structure Of A Full-Length Bacterial Lov Protein Length = 162 Back     alignment and structure
>pdb|3IS2|B Chain B, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 Back     alignment and structure
>pdb|3IS2|A Chain A, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 Back     alignment and structure
>pdb|3HJK|A Chain A, 2.0 Angstrom Structure Of The Ile74val Variant Of Vivid (Vvd). Length = 154 Back     alignment and structure
>pdb|3HJI|A Chain A, 1.8 Angstrom Crystal Structure Of The I74v:i85v Variant Of Vivid (Vvd). Length = 154 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query545
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 4e-60
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 5e-42
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 6e-38
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 9e-05
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 1e-24
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 4e-24
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 6e-24
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 5e-23
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 2e-22
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 2e-22
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 3e-22
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 6e-22
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 1e-21
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 3e-21
1byw_A110 Protein (human ERG potassium channel); PAS domain, 3e-21
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 1e-19
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 2e-19
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 5e-19
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-18
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-11
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-09
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-17
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-15
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-16
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 7e-08
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-16
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-13
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-16
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-14
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-15
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-06
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 3e-11
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 2e-04
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 5e-11
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 6e-09
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 8e-09
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 7e-06
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 1e-08
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 2e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-07
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 3e-05
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 1e-04
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 1e-04
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 2e-04
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  210 bits (535), Expect = 4e-60
 Identities = 68/395 (17%), Positives = 125/395 (31%), Gaps = 48/395 (12%)

Query: 147 ILSWLSPRDIASVGSVCRRFYELTKNEDLWRMVCQNAWGSETTRVLETVPGAKRLGWGRL 206
           +           +  V           + + + C +      T   E             
Sbjct: 312 LWESADEATKKELLKVE-----PFDELEEFHLFCHHYVLCHATNYKEFAFTQGF--LFDR 364

Query: 207 ARELTTLEAATWRKLTVGGTVEPSRCNFSACAV-GNRVVLFGGEGVNMQPMNDTFVLDLN 265
           +     L      +L       P    F    V GN V   GG   N   +N+   L ++
Sbjct: 365 SISEINLTVDEDYQLLECEC--PINRKFGDVDVAGNDVFYMGGS--NPYRVNEILQLSIH 420

Query: 266 SSNPEWQHVHVSSP--PPGRWGHTLSCV--NGSHLVVFGGCGRQGLLNDVFVLDLDAKPP 321
               + +++ VSS   P  R  HT + +  N   L++ G       L+D ++ D+  +  
Sbjct: 421 YDKIDMKNIEVSSSEVPVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDMKTR-- 478

Query: 322 TWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPV 381
            W  I  L     R  HS+C+L    +++ GG  +   +L    L +++ E   ++++  
Sbjct: 479 EWSMIKSL--SHTRFRHSACSLPDGNVLILGGVTEGPAML----LYNVTEEI--FKDVTP 530

Query: 382 TWT-PPSRLGHTLSVYGG---RKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTG 437
                 + L      +     + I++ GG      +    + +F  D          +  
Sbjct: 531 KDEFFQNSLVSAGLEFDPVSKQGIILGGGFMDQTTVS-DKAIIFKYDAENATEPITVIKK 589

Query: 438 SGMPGAGNPGGIAPPPRLDHVAVSLPGGRILIFGG-SVAGLHSATQ-LYLLDPTEEKPTW 495
              P            R       +   ++LI GG S +GL   T  +  LDP     T 
Sbjct: 590 LQHP---------LFQRYGSQIKYITPRKLLIVGGTSPSGLFDRTNSIISLDP--LSETL 638

Query: 496 RILNVPGR----PPRFAWGHSTCVVGGTRTIVLGG 526
             + +  R          G S          ++GG
Sbjct: 639 TSIPISRRIWEDHSLMLAGFSLVSTSMGTIHIIGG 673
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Length = 149 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Length = 115 Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Length = 258 Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Length = 166 Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Length = 146 Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Length = 128 Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Length = 110 Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Length = 132 Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Length = 138 Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Length = 162 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Length = 124 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Length = 120 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query545
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.98
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.98
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.97
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 99.37
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 99.36
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 99.18
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 99.17
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.02
3mr0_A142 Sensory box histidine kinase/response regulator; P 99.02
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 98.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.96
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 98.96
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 98.92
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 98.91
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 98.91
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 98.9
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 98.9
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 98.89
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.78
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.74
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 98.72
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 98.7
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 98.65
1byw_A110 Protein (human ERG potassium channel); PAS domain, 98.63
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 98.63
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 98.62
3nja_A125 Probable ggdef family protein; structural genomics 98.61
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 98.59
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 98.57
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 98.51
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 98.44
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 98.44
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.43
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 98.43
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 98.39
3icy_A118 Sensor protein; sensory box histidine kinase/respo 98.39
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 98.35
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 98.21
2r78_A117 Sensor protein; sensory box sensor histidine kinas 98.15
4f3l_A361 Mclock, circadian locomoter output cycles protein 98.15
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 98.14
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.11
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 98.05
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.03
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.03
3mjq_A126 Uncharacterized protein; NESG, structural genomics 97.96
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.93
3eeh_A125 Putative light and redox sensing histidine kinase; 97.9
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 97.81
3vol_A233 Aerotaxis transducer AER2; heme, oxygen sensor pro 97.68
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.62
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.59
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.54
3olo_A118 Two-component sensor histidine kinase; structural 97.49
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 97.4
2qkp_A151 Uncharacterized protein; structural genomics, unkn 97.33
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 97.33
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.33
3rty_A339 Period circadian protein; PAS domain, signalling, 97.33
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 97.22
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.17
3cax_A369 Uncharacterized protein PF0695; structural genomic 97.15
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.12
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.07
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 96.99
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.98
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.93
3jrp_A379 Fusion protein of protein transport protein SEC13 96.9
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 96.86
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 96.7
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.69
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.63
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 96.61
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.6
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.56
3jro_A 753 Fusion protein of protein transport protein SEC13 96.49
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.48
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 96.48
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.45
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.45
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.42
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.41
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.38
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.36
3b33_A115 Sensor protein; structural genomics, PAS domain, n 96.32
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 96.28
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.23
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.22
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 96.22
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.22
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.2
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.18
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.18
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.12
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.08
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 96.05
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.97
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.95
3rty_A339 Period circadian protein; PAS domain, signalling, 95.94
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.92
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.87
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 95.86
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.85
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.78
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.74
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.7
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 95.69
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.66
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.63
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.61
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.47
3jrp_A379 Fusion protein of protein transport protein SEC13 95.47
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.41
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.14
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.13
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.1
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.02
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 95.02
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.99
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.9
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.87
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 94.76
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.44
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 94.35
1mzu_A129 PPR; photoactive yellow protein, PAS, PYP, signali 94.33
1nwz_A125 PYP, photoactive yellow protein; PAS, LOV, GAF, do 94.26
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.23
4e54_B435 DNA damage-binding protein 2; beta barrel, double 94.19
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 94.11
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.06
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 93.96
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 93.95
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 93.92
4g56_B357 MGC81050 protein; protein arginine methyltransfera 93.85
3jro_A 753 Fusion protein of protein transport protein SEC13 93.84
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.81
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 93.78
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 93.78
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.66
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 93.56
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 93.42
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 93.41
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 93.38
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 93.33
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 93.3
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.28
3v9f_A781 Two-component system sensor histidine kinase/RESP 93.16
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.95
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 92.76
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 92.59
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 92.56
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 92.52
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 92.5
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 92.44
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 92.37
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.3
4g56_B357 MGC81050 protein; protein arginine methyltransfera 92.26
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 92.01
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 91.98
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 91.92
4a2l_A795 BT_4663, two-component system sensor histidine kin 91.88
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 91.87
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.83
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 91.67
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 91.59
4e54_B435 DNA damage-binding protein 2; beta barrel, double 91.45
4d9s_A406 UVB-resistance protein UVR8; UV resistance, UV-B p 91.39
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 91.37
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 91.35
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 91.17
3ow8_A321 WD repeat-containing protein 61; structural genomi 91.08
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 90.99
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 90.98
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 90.91
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 90.48
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 90.12
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 89.91
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 89.6
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 89.08
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 89.08
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 89.0
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 88.96
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 88.7
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 88.53
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 88.16
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 88.05
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 87.98
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 87.93
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 87.64
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 87.6
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 87.58
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 87.42
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 87.4
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 87.09
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 86.85
4f3l_A361 Mclock, circadian locomoter output cycles protein 86.77
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 86.42
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 86.19
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 86.1
1itv_A195 MMP9; adaptive molecular recognition, beta propell 86.04
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 85.99
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 85.98
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 85.78
2ykf_A305 Pdtas, probable sensor histidine kinase pdtas; tra 85.83
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 85.64
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 85.44
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 85.38
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 85.37
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 85.36
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 85.36
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 84.99
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 84.64
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 84.39
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 84.13
2pm7_B297 Protein transport protein SEC13, protein transport 83.99
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 83.98
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 83.46
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 83.45
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 83.05
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 82.63
2pm7_B297 Protein transport protein SEC13, protein transport 82.6
3ow8_A321 WD repeat-containing protein 61; structural genomi 82.4
2xyi_A430 Probable histone-binding protein CAF1; transcripti 81.8
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 81.36
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 81.3
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 81.08
2ykf_A305 Pdtas, probable sensor histidine kinase pdtas; tra 82.0
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 80.91
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 80.86
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 80.68
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 80.62
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 80.41
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=8.6e-42  Score=332.59  Aligned_cols=274  Identities=16%  Similarity=0.186  Sum_probs=228.0

Q ss_pred             CCCCCCCceeeEEECCEEEEEcCCCCCCCccCceEEEeCCCCCCceEEeccCCCCCCccceeEEEEcCCEEEEEcCC---
Q 042793          226 TVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWGHTLSCVNGSHLVVFGGC---  302 (545)
Q Consensus       226 ~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~d~~t~~~~W~~~~~~~~~~~r~~~~~~~~~~~~iyv~GG~---  302 (545)
                      +.|++|..|+++.++++||+|||.  ....++++++||+.++  +|+.++  ++|.+|.+|+++++ +++|||+||.   
T Consensus        10 ~~~~~~~~~~~~~~~~~i~v~GG~--~~~~~~~~~~~d~~~~--~W~~~~--~~p~~r~~~~~~~~-~~~lyv~GG~~~~   82 (308)
T 1zgk_A           10 SSGLVPRGSHAPKVGRLIYTAGGY--FRQSLSYLEAYNPSNG--TWLRLA--DLQVPRSGLAGCVV-GGLLYAVGGRNNS   82 (308)
T ss_dssp             -----------CCCCCCEEEECCB--SSSBCCCEEEEETTTT--EEEECC--CCSSCCBSCEEEEE-TTEEEEECCEEEE
T ss_pred             cCCeeeCCccccCCCCEEEEEeCc--CCCCcceEEEEcCCCC--eEeECC--CCCcccccceEEEE-CCEEEEECCCcCC
Confidence            457789999999999999999998  3567889999999998  999885  88999999998877 5599999998   


Q ss_pred             -CCCcccCcEEEEecCCCCCceEeccCCCCCCCCccceEEEEcCCEEEEEcCCCCCCCccCcEEEEecCCCCCceEEecC
Q 042793          303 -GRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSMEKPVWREIPV  381 (545)
Q Consensus       303 -~~~~~~~~~~~yd~~t~~~~W~~~~~~~~~~~r~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~d~~~~~~~W~~~~~  381 (545)
                       ......+++++||+.++  +|+.++++  |.+|..|+++.+ +++|||+||... ...++++++||+.  +++|+.++.
T Consensus        83 ~~~~~~~~~~~~~d~~~~--~W~~~~~~--p~~r~~~~~~~~-~~~iyv~GG~~~-~~~~~~~~~yd~~--~~~W~~~~~  154 (308)
T 1zgk_A           83 PDGNTDSSALDCYNPMTN--QWSPCAPM--SVPRNRIGVGVI-DGHIYAVGGSHG-CIHHNSVERYEPE--RDEWHLVAP  154 (308)
T ss_dssp             TTEEEECCCEEEEETTTT--EEEECCCC--SSCCBTCEEEEE-TTEEEEECCEET-TEECCCEEEEETT--TTEEEECCC
T ss_pred             CCCCeecceEEEECCCCC--eEeECCCC--CcCccccEEEEE-CCEEEEEcCCCC-CcccccEEEECCC--CCeEeECCC
Confidence             44457899999999999  99999988  889999999988 459999999754 3467899999954  669999976


Q ss_pred             CCCCCCCCCcEEEEECCcEEEEEcccCCCCCCccccCcEEEEeCCCCCCceEEeecCCCCCCCCCCCCCCCCCcceEEEE
Q 042793          382 TWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPGGIAPPPRLDHVAVS  461 (545)
Q Consensus       382 ~~~p~~r~~~~~~~~~~~~lyi~GG~~~~~~~~~~~~~i~~~d~~~~~~~W~~v~~~~~~~~~~~~g~~p~~r~~~~~~~  461 (545)
                        +|.+|.+|+++.+++ +||++||......    .++++.||+.  +++|+.+..+            |.+|..|++++
T Consensus       155 --~p~~r~~~~~~~~~~-~iyv~GG~~~~~~----~~~~~~yd~~--~~~W~~~~~~------------p~~r~~~~~~~  213 (308)
T 1zgk_A          155 --MLTRRIGVGVAVLNR-LLYAVGGFDGTNR----LNSAECYYPE--RNEWRMITAM------------NTIRSGAGVCV  213 (308)
T ss_dssp             --CSSCCBSCEEEEETT-EEEEECCBCSSCB----CCCEEEEETT--TTEEEECCCC------------SSCCBSCEEEE
T ss_pred             --CCccccceEEEEECC-EEEEEeCCCCCCc----CceEEEEeCC--CCeEeeCCCC------------CCccccceEEE
Confidence              899999999999977 9999999876543    6899999999  8999999765            88999998888


Q ss_pred             ecCCEEEEEcCcCCCCCCCCceEEEcCCCCCCceEEeccCCCCCCCCCCceeEEeCCeeEEEEcCCCCcccccccceeee
Q 042793          462 LPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTRTIVLGGQTGEEWMLSELHELS  541 (545)
Q Consensus       462 ~~~~~l~v~GG~~~~~~~~~~v~~~d~~~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~~l~i~GG~~~~~~~~~~~~~l~  541 (545)
                      + +++|||+||.+.. ...+++++||++  +++|+.+   +.+|.+|.+|+++++ +++|||+||.+... .++++++||
T Consensus       214 ~-~~~iyv~GG~~~~-~~~~~v~~yd~~--~~~W~~~---~~~p~~r~~~~~~~~-~~~i~v~GG~~~~~-~~~~v~~yd  284 (308)
T 1zgk_A          214 L-HNCIYAAGGYDGQ-DQLNSVERYDVE--TETWTFV---APMKHRRSALGITVH-QGRIYVLGGYDGHT-FLDSVECYD  284 (308)
T ss_dssp             E-TTEEEEECCBCSS-SBCCCEEEEETT--TTEEEEC---CCCSSCCBSCEEEEE-TTEEEEECCBCSSC-BCCEEEEEE
T ss_pred             E-CCEEEEEeCCCCC-CccceEEEEeCC--CCcEEEC---CCCCCCccceEEEEE-CCEEEEEcCcCCCc-ccceEEEEc
Confidence            7 9999999998743 347899999996  7899999   468889999999888 78999999988654 579999999


Q ss_pred             ecc
Q 042793          542 LVS  544 (545)
Q Consensus       542 l~~  544 (545)
                      +.+
T Consensus       285 ~~~  287 (308)
T 1zgk_A          285 PDT  287 (308)
T ss_dssp             TTT
T ss_pred             CCC
Confidence            875
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 Back     alignment and structure
>1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4d9s_A UVB-resistance protein UVR8; UV resistance, UV-B photoreceptor, tryptophan chromophores, homodimer, COP1, chromatin-binding protein; 1.70A {Arabidopsis thaliana} PDB: 4dnw_A 4dnu_A 4dnv_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 545
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 4e-11
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 2e-10
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 2e-08
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 1e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-05
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-05
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 6e-05
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 0.001
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD-repeat protein 1 (beta-TRCP1)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 58.2 bits (140), Expect = 4e-11
 Identities = 16/86 (18%), Positives = 35/86 (40%), Gaps = 2/86 (2%)

Query: 137 QLSDEVISLKILSWLSPRDIASVGSVCRRFYELTKNEDLWR-MVCQNAWGSETTRVLETV 195
           +  D +    ILS+L  + + +   VC+ +Y +T +  LW+ ++ +        R L   
Sbjct: 17  RGLDHIA-ENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAER 75

Query: 196 PGAKRLGWGRLARELTTLEAATWRKL 221
            G  +  +     +      + +R L
Sbjct: 76  RGWGQYLFKNKPPDGNAPPNSFYRAL 101
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query545
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.97
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.92
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 99.46
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 99.4
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 99.22
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 98.97
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.6
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.41
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 98.33
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 98.2
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.03
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 97.93
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.72
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 97.49
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 97.35
d1nwza_125 Photoactive yellow protein, PYP {Ectothiorhodospir 97.25
d1mzua_110 PYP domain of sensor histidine kinase Ppr {Rhodosp 96.38
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 95.32
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.62
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.92
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.53
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 93.51
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.2
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.09
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 92.73
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 92.57
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 91.71
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 91.45
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 91.23
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.14
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 90.91
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 89.41
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 89.24
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 88.98
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 88.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 88.47
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 88.38
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 87.96
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 87.77
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 87.43
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 87.25
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 86.66
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 86.63
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 86.35
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 84.94
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 84.87
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 84.52
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 83.28
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 80.1
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.2e-35  Score=282.23  Aligned_cols=263  Identities=19%  Similarity=0.247  Sum_probs=224.7

Q ss_pred             hhhhcccCCcEEeccCCCCCCCCCceeeEEECCEEEEEcCCCCC---CCccCceEEEeCCCCCCceEEeccCCCCCCccc
Q 042793          209 ELTTLEAATWRKLTVGGTVEPSRCNFSACAVGNRVVLFGGEGVN---MQPMNDTFVLDLNSSNPEWQHVHVSSPPPGRWG  285 (545)
Q Consensus       209 ~~~~~~~~~W~~~~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~---~~~~~~~~~~d~~t~~~~W~~~~~~~~~~~r~~  285 (545)
                      ++||+.+++|..++.   +|.+|.+|++++++++|||+||....   ...++++++||+.++  +|+.++  ++|.+|..
T Consensus        22 ~~yd~~t~~W~~~~~---~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~--~w~~~~--~~p~~r~~   94 (288)
T d1zgka1          22 EAYNPSNGTWLRLAD---LQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTN--QWSPCA--PMSVPRNR   94 (288)
T ss_dssp             EEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTT--EEEECC--CCSSCCBT
T ss_pred             EEEECCCCeEEECCC---CCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccc--cccccc--cccceecc
Confidence            479999999999864   78899999999999999999996322   245789999999998  999876  89999999


Q ss_pred             eeEEEEcCCEEEEEcCCCCCcccCcEEEEecCCCCCceEeccCCCCCCCCccceEEEEcCCEEEEEcCCCCCCCccCcEE
Q 042793          286 HTLSCVNGSHLVVFGGCGRQGLLNDVFVLDLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTF  365 (545)
Q Consensus       286 ~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~t~~~~W~~~~~~~~~~~r~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~  365 (545)
                      |+++.++ +++|++||.......++++.||+.++  .|...+.+  +.+|..|+++... +++|++||... .....+++
T Consensus        95 ~~~~~~~-~~i~~~gg~~~~~~~~~~~~~~~~~~--~~~~~~~~--~~~r~~~~~~~~~-~~~~~~GG~~~-~~~~~~~~  167 (288)
T d1zgka1          95 IGVGVID-GHIYAVGGSHGCIHHNSVERYEPERD--EWHLVAPM--LTRRIGVGVAVLN-RLLYAVGGFDG-TNRLNSAE  167 (288)
T ss_dssp             CEEEEET-TEEEEECCEETTEECCCEEEEETTTT--EEEECCCC--SSCCBSCEEEEET-TEEEEECCBCS-SCBCCCEE
T ss_pred             eeccccc-eeeEEecceecccccceeeeeccccC--cccccccc--ccccccceeeeee-ecceEecCccc-ccccceEE
Confidence            9998885 59999999988888899999999999  99998876  7889999998884 59999999854 45677899


Q ss_pred             EEecCCCCCceEEecCCCCCCCCCCcEEEEECCcEEEEEcccCCCCCCccccCcEEEEeCCCCCCceEEeecCCCCCCCC
Q 042793          366 LLDLSMEKPVWREIPVTWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLRFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGN  445 (545)
Q Consensus       366 ~~d~~~~~~~W~~~~~~~~p~~r~~~~~~~~~~~~lyi~GG~~~~~~~~~~~~~i~~~d~~~~~~~W~~v~~~~~~~~~~  445 (545)
                      .||+.  +.+|.....  .+.++..++++.+++ +++++||......    .++.+.||+.  +++|..+...       
T Consensus       168 ~~d~~--~~~~~~~~~--~~~~~~~~~~~~~~~-~i~i~GG~~~~~~----~~~~~~~~~~--~~~~~~~~~~-------  229 (288)
T d1zgka1         168 CYYPE--RNEWRMITA--MNTIRSGAGVCVLHN-CIYAAGGYDGQDQ----LNSVERYDVE--TETWTFVAPM-------  229 (288)
T ss_dssp             EEETT--TTEEEECCC--CSSCCBSCEEEEETT-EEEEECCBCSSSB----CCCEEEEETT--TTEEEECCCC-------
T ss_pred             Eeecc--ccccccccc--cccccccccccceee-eEEEecCcccccc----ccceeeeeec--ceeeecccCc-------
Confidence            99954  669998865  777888899988987 9999999876553    6899999999  8899998755       


Q ss_pred             CCCCCCCCCcceEEEEecCCEEEEEcCcCCCCCCCCceEEEcCCCCCCceEEeccCCCCCCCCCCceeEE
Q 042793          446 PGGIAPPPRLDHVAVSLPGGRILIFGGSVAGLHSATQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCV  515 (545)
Q Consensus       446 ~~g~~p~~r~~~~~~~~~~~~l~v~GG~~~~~~~~~~v~~~d~~~~~~~W~~~~~~~~~p~~r~~~~~~~  515 (545)
                           |.+|..|+++.+ +++|||+||.+. ...++++++||++  +++|+.+   +.+|.+|.+|++++
T Consensus       230 -----p~~r~~~~~~~~-~~~l~v~GG~~~-~~~~~~v~~yd~~--~~~W~~~---~~~p~~R~~~~~~~  287 (288)
T d1zgka1         230 -----KHRRSALGITVH-QGRIYVLGGYDG-HTFLDSVECYDPD--TDTWSEV---TRMTSGRSGVGVAV  287 (288)
T ss_dssp             -----SSCCBSCEEEEE-TTEEEEECCBCS-SCBCCEEEEEETT--TTEEEEE---EECSSCCBSCEEEE
T ss_pred             -----cCcccceEEEEE-CCEEEEEecCCC-CeecceEEEEECC--CCEEEEC---CCCCCCcEeEEEEE
Confidence                 889999988877 999999999864 3456899999996  7899999   56899999998775
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure