Citrus Sinensis ID: 042846


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MVRAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKKRKNKDPASSSSTQEHSYNNEETSQSDQAESERLNLADHTPLAVLESSPISPSTLSSSDHHHRHAIASGAKSLFEDINGDFWTQPFLSDNNYNQNNHYSSLSYDSCYEDSIDQFYQALQELQEFDVDFSW
ccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHcccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHcccccccHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccc
cccccccHHcccccccccHHHHHHHHHHHHHcccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccHcccHHccccccccccccccccccccccccccccccccccccccccccccc
mvraptydengmkkgawskeEDDKLRAYILKYGhwnwgelpkfaglsrcgkscRLRWMnylrpdikhgnytkeEEDTIIRLRQQHGNKWSLIaaklpgrtdneiKNYWHTHLkkrknkdpasssstqehsynneetsqsdqaeserlnladhtplavlesspispstlsssdhhhRHAIASGAKSLFedingdfwtqpflsdnnynqnnhysslsydscyeDSIDQFYQALQELQefdvdfsw
mvraptydengmkkgawskeedDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNylrpdikhgnytkEEEDTIIRLRQQHGNKWSliaaklpgrtdnEIKNYWHThlkkrknkdpasssstqehsynneetsqsDQAESERLNLADHTPLAVLESSPISPSTLSSSDHHHRHAIASGAKSLFEDINGDFWTQPFLSDNNYNQNNHYSSLSYDSCYEDSIDQFYQALQELQEFDVDFSW
MVRAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKKRKNKDPASSSSTQEHSYNNEETSQSDQAESERLNLADHTPLAVLEsspispstlsssDHHHRHAIASGAKSLFEDINGDFWTQPFLSDNNYNQNNHYSSLSYDSCYEDSIDQFYQALQELQEFDVDFSW
***********************KLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWH*************************************************************************AKSLFEDINGDFWTQPFLSDNNYNQNNHYSSLSYDSCYEDSIDQFYQALQELQEFDV****
**RAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKK****************************************************************************NGDFWTQPFLSDNNY******************************EFDVDFSW
*************KGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHL**********************************LNLADHTPLAVLES****************HAIASGAKSLFEDINGDFWTQPFLSDNNYNQNNHYSSLSYDSCYEDSIDQFYQALQELQEFDVDFSW
***APTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKKRKNKD***********************************************************************NG*FWT**FL*******************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKKRKNKDPASSSSTQEHSYNNEETSQSDQAESERLNLADHTPLAVLESSPISPSTLSSSDHHHRHAIASGAKSLFEDINGDFWTQPFLSDNNYNQNNHYSSLSYDSCYEDSIDQFYQALQELQEFDVDFSW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
Q7XBH4257 Myb-related protein Myb4 no no 0.473 0.447 0.695 2e-43
O49608274 Transcription factor MYB3 no no 0.629 0.558 0.528 1e-41
Q9SZP1282 Transcription repressor M no no 0.617 0.531 0.519 4e-41
P81393232 Myb-related protein 308 O N/A no 0.567 0.594 0.537 1e-40
Q9S9K9257 Transcription factor MYB3 no no 0.716 0.677 0.468 2e-40
Q8GWP0 360 Transcription factor MYB3 no no 0.473 0.319 0.646 4e-40
P20024340 Myb-related protein Zm1 O N/A no 0.465 0.332 0.663 4e-40
P20025255 Myb-related protein Zm38 N/A no 0.502 0.478 0.576 4e-39
P20026267 Myb-related protein Hv1 O N/A no 0.563 0.513 0.539 6e-39
P81394268 Myb-related protein 315 O N/A no 0.592 0.537 0.544 3e-38
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function desciption
 Score =  176 bits (445), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 80/115 (69%), Positives = 93/115 (80%)

Query: 1   MVRAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNY 60
           M RAP  ++ G+KKG W+ EED  L A+I ++GH NW  LPK AGL RCGKSCRLRW+NY
Sbjct: 1   MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINY 60

Query: 61  LRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKKR 115
           LRPDIK GN++KEEEDTII L +  GN+WS IAA+LPGRTDNEIKN WHTHLKKR
Sbjct: 61  LRPDIKRGNFSKEEEDTIIHLHELLGNRWSAIAARLPGRTDNEIKNVWHTHLKKR 115




Putative transcription factor which is may be involved in cold stress response.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 Back     alignment and function description
>sp|P20024|MYB1_MAIZE Myb-related protein Zm1 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description
>sp|P81394|MYB15_ANTMA Myb-related protein 315 OS=Antirrhinum majus GN=MYB315 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
224145550263 predicted protein [Populus trichocarpa] 0.962 0.889 0.517 4e-67
224145552262 predicted protein [Populus trichocarpa] 0.958 0.889 0.494 3e-59
356515226216 PREDICTED: myb-related protein Myb4-like 0.794 0.893 0.512 2e-54
225447695252 PREDICTED: transcription repressor MYB4 0.921 0.888 0.483 5e-54
224126823256 predicted protein [Populus trichocarpa] 0.876 0.832 0.478 5e-53
302398929253 MYB domain class transcription factor [M 0.864 0.830 0.469 1e-52
449438468271 PREDICTED: transcription repressor MYB4- 0.843 0.756 0.495 2e-52
147837078284 hypothetical protein VITISV_019320 [Viti 0.860 0.735 0.480 3e-52
225447697257 PREDICTED: myb-related protein Myb4 [Vit 0.860 0.813 0.471 3e-52
269784588255 putative MYB transcription factor [Diosp 0.962 0.917 0.476 5e-51
>gi|224145550|ref|XP_002325682.1| predicted protein [Populus trichocarpa] gi|222862557|gb|EEF00064.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  260 bits (664), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 134/259 (51%), Positives = 174/259 (67%), Gaps = 25/259 (9%)

Query: 1   MVRAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNY 60
           MVRAP +D+NG+KKGAWS+EEDDKLR +I KYG WNW E+PKFAGLSRCGKSCRLRWMNY
Sbjct: 1   MVRAPYFDKNGVKKGAWSEEEDDKLREHIEKYGLWNWREIPKFAGLSRCGKSCRLRWMNY 60

Query: 61  LRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKKRKNKDP 120
           LRPD+KHGNYTKEEED I++L ++HGNKWS+IAAKLPGRTDNE+KNYWH HLKKR  +  
Sbjct: 61  LRPDVKHGNYTKEEEDLILKLHEKHGNKWSIIAAKLPGRTDNEVKNYWHAHLKKRTVEKQ 120

Query: 121 ASSSSTQEHS-YNNEETSQSDQAESERLNLADHTPL-AVLESSPISPST----------- 167
            +    ++ S + +E        E E   +  +TP   +LES+P+SP T           
Sbjct: 121 NTLVLKEKSSGFTSESEGSQMNKEMEAKTVVSYTPSNPILESTPLSPETSCSELSNLSTD 180

Query: 168 ----LSSSDHHHRHAIASGAKS---LFEDINGDFWTQPFLSDNNYNQNN-----HYSSLS 215
               L  S   +R+ IA    S    F++  G+FWT+PF++D+ Y+Q+N      Y    
Sbjct: 181 FAPKLPVSAGTNRNNIAEDVLSSVPTFDESIGNFWTEPFVADSAYDQDNFPGLSFYQEEP 240

Query: 216 YDSCYEDSIDQFYQALQEL 234
           + S Y+D ID +Y+ +QEL
Sbjct: 241 FVSYYDDGIDFYYEMMQEL 259




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224145552|ref|XP_002325683.1| predicted protein [Populus trichocarpa] gi|222862558|gb|EEF00065.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356515226|ref|XP_003526302.1| PREDICTED: myb-related protein Myb4-like [Glycine max] Back     alignment and taxonomy information
>gi|225447695|ref|XP_002276962.1| PREDICTED: transcription repressor MYB4 [Vitis vinifera] gi|296081258|emb|CBI18002.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224126823|ref|XP_002319935.1| predicted protein [Populus trichocarpa] gi|222858311|gb|EEE95858.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302398929|gb|ADL36759.1| MYB domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|449438468|ref|XP_004137010.1| PREDICTED: transcription repressor MYB4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147837078|emb|CAN72480.1| hypothetical protein VITISV_019320 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447697|ref|XP_002272704.1| PREDICTED: myb-related protein Myb4 [Vitis vinifera] gi|296081257|emb|CBI18001.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|269784588|dbj|BAI49720.1| putative MYB transcription factor [Diospyros kaki] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
TAIR|locus:2086233285 MYB15 "myb domain protein 15" 0.609 0.519 0.588 5.3e-45
TAIR|locus:2149000336 MYB9 "myb domain protein 9" [A 0.530 0.383 0.628 8.6e-45
TAIR|locus:2087690239 MYB10 "myb domain protein 10" 0.596 0.606 0.606 9.1e-45
TAIR|locus:2032860274 MYB58 "myb domain protein 58" 0.954 0.846 0.412 3.5e-43
TAIR|locus:2042526249 MYB14 "myb domain protein 14" 0.567 0.554 0.608 1.2e-42
TAIR|locus:2023951 365 MYB93 "myb domain protein 93" 0.473 0.315 0.652 2.8e-42
TAIR|locus:2115708324 MYB74 "myb domain protein 74" 0.502 0.376 0.626 7.5e-42
TAIR|locus:2207330294 MYB63 "myb domain protein 63" 0.555 0.459 0.588 8.4e-42
TAIR|locus:2038520246 MYB13 "myb domain protein 13" 0.938 0.926 0.425 1.1e-41
TAIR|locus:2011786296 MYB72 "myb domain protein 72" 0.588 0.483 0.579 1.1e-41
TAIR|locus:2086233 MYB15 "myb domain protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 452 (164.2 bits), Expect = 5.3e-45, Sum P(2) = 5.3e-45
 Identities = 93/158 (58%), Positives = 112/158 (70%)

Query:     1 MVRAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNY 60
             M RAP  ++ G+K+G W+ EED  L ++IL +GH NW  LPK AGL RCGKSCRLRWMNY
Sbjct:     1 MGRAPCCEKMGLKRGPWTPEEDQILVSFILNHGHSNWRALPKQAGLLRCGKSCRLRWMNY 60

Query:    61 LRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKKR-KNKD 119
             L+PDIK GN+TKEEED II L Q  GN+WS IAAKLPGRTDNEIKN WHTHLKKR ++  
Sbjct:    61 LKPDIKRGNFTKEEEDAIISLHQILGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLEDYQ 120

Query:   120 PASSSS------TQEHSYNNEETSQSDQAESERLNLAD 151
             PA   +      T+  S +   +S S ++ESE   LAD
Sbjct:   121 PAKPKTSNKKKGTKPKSESVITSSNSTRSESE---LAD 155


GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP;RCA
GO:0009733 "response to auxin stimulus" evidence=IEP;RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP;RCA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0010200 "response to chitin" evidence=IEP;RCA
GO:0002679 "respiratory burst involved in defense response" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0035556 "intracellular signal transduction" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0052542 "defense response by callose deposition" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2149000 MYB9 "myb domain protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087690 MYB10 "myb domain protein 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032860 MYB58 "myb domain protein 58" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042526 MYB14 "myb domain protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2023951 MYB93 "myb domain protein 93" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115708 MYB74 "myb domain protein 74" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207330 MYB63 "myb domain protein 63" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011786 MYB72 "myb domain protein 72" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 3e-46
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 8e-44
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 4e-14
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-13
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-11
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 9e-11
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 2e-09
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 9e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 5e-08
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-07
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
 Score =  154 bits (389), Expect = 3e-46
 Identities = 82/189 (43%), Positives = 114/189 (60%), Gaps = 13/189 (6%)

Query: 5   PTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPD 64
           P   + GMK+G W+ EED+ L ++I K G   W  LPK AGL RCGKSCRLRWMNYLRP 
Sbjct: 16  PCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPS 75

Query: 65  IKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKK---RKNKDPA 121
           +K G  T +EED I+RL +  GN+WSLIA ++PGRTDNEIKNYW+THL+K   R+  DP 
Sbjct: 76  VKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQ 135

Query: 122 SSSSTQEHSYNNEETSQSDQAESERLNLADHTPLAVLESSPISPSTLSSSDHHHRHAI-A 180
           +      ++ +  E         E ++     P+  + SS    +T++  D   +++I  
Sbjct: 136 THKPLDANNIHKPE---------EEVSGGQKYPIEPISSSHTDDTTVNGGDGDSKNSINV 186

Query: 181 SGAKSLFED 189
            G +  +ED
Sbjct: 187 FGGEHGYED 195


Length = 249

>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
PLN03212249 Transcription repressor MYB5; Provisional 100.0
PLN03091 459 hypothetical protein; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.79
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.77
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.69
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.6
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.55
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.49
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.47
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.43
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.42
PLN03212249 Transcription repressor MYB5; Provisional 99.38
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.29
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.28
PLN03091 459 hypothetical protein; Provisional 99.26
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.16
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.16
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.08
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.02
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.7
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.07
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.87
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.79
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.65
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.56
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.35
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.3
KOG1279506 consensus Chromatin remodeling factor subunit and 97.16
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.1
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.95
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.93
KOG1279506 consensus Chromatin remodeling factor subunit and 96.77
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.76
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.73
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.53
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.47
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.15
PRK13923170 putative spore coat protein regulator protein YlbO 95.84
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.79
PRK13923170 putative spore coat protein regulator protein YlbO 95.71
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.58
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.47
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.2
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 93.29
KOG2656 445 consensus DNA methyltransferase 1-associated prote 92.61
KOG4282 345 consensus Transcription factor GT-2 and related pr 92.32
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 91.99
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 88.78
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 87.41
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 87.3
KOG4282345 consensus Transcription factor GT-2 and related pr 85.35
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 82.29
KOG1194 534 consensus Predicted DNA-binding protein, contains 81.74
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.2e-38  Score=279.09  Aligned_cols=121  Identities=56%  Similarity=1.048  Sum_probs=115.1

Q ss_pred             CCCCCCCCCCccCCCCHHHHHHHHHHHHHhCCCCcccccccccCccchhhhhhhhhcccCCCCCCCCCChHHHHHHHHHH
Q 042846            3 RAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYTKEEEDTIIRLR   82 (243)
Q Consensus         3 r~p~~~k~~lkKg~WT~EED~~L~~~V~~~g~~nW~~Ia~~l~~~Rt~kqcr~Rw~n~L~p~i~r~~WT~EED~~Ll~lv   82 (243)
                      |+|||.|++++||+||+|||++|+++|++||..+|..||+.++++|+++|||+||.++|+|.+++++||.|||++|++++
T Consensus        14 ~~pcc~K~glKRg~WT~EEDe~L~~lV~kyG~~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~lLlel~   93 (249)
T PLN03212         14 TTPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLILRLH   93 (249)
T ss_pred             CCCCcccCCCcCCCCCHHHHHHHHHHHHHhCcccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHHHHHHH
Confidence            68999999999999999999999999999999899999999876899999999999999999999999999999999999


Q ss_pred             HHhCCchHHhhccCCCCCHHHHHHHHHHhhccccCCCCCCC
Q 042846           83 QQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKKRKNKDPASS  123 (243)
Q Consensus        83 ~~~G~~Ws~Ia~~lpgRT~~q~knrw~~~lkk~~~k~~~s~  123 (243)
                      ..||++|+.||++|||||+++|||||+.++++++.+.....
T Consensus        94 ~~~GnKWs~IAk~LpGRTDnqIKNRWns~LrK~l~r~~i~p  134 (249)
T PLN03212         94 RLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDP  134 (249)
T ss_pred             HhccccHHHHHhhcCCCCHHHHHHHHHHHHhHHHHhcCCCC
Confidence            99999999999999999999999999999999877655443



>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 4e-19
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 7e-19
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 4e-06
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 2e-18
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 2e-18
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 5e-05
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-18
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 6e-05
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 4e-18
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 4e-13
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 1e-09
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 1e-06
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 2e-06
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 4e-05
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 1e-04
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 1e-04
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 3e-04
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 1e-04
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 5e-04
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure

Iteration: 1

Score = 91.7 bits (226), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 42/104 (40%), Positives = 70/104 (67%), Gaps = 1/104 (0%) Query: 12 MKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYT 71 + KG W+KEED ++ ++ KYG W ++ K R GK CR RW N+L P++K ++T Sbjct: 25 LNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLK-GRIGKQCRERWHNHLNPEVKKTSWT 83 Query: 72 KEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKKR 115 +EE+ I + ++ GN+W+ IA LPGRTDN +KN+W++ ++++ Sbjct: 84 EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRK 127
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 7e-64
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 3e-63
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 4e-06
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 7e-63
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 4e-20
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 1e-54
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 8e-53
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 7e-36
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-04
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 2e-52
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-25
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-06
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 8e-24
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 6e-09
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 2e-19
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 2e-09
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 6e-14
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-07
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 6e-09
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-06
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 6e-09
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 5e-07
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-06
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 4e-06
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 2e-04
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 5e-06
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 5e-06
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 1e-04
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 2e-05
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 5e-05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 1e-04
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 1e-04
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 7e-04
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 2e-04
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 2e-04
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-04
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 2e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score =  194 bits (495), Expect = 7e-64
 Identities = 44/125 (35%), Positives = 67/125 (53%), Gaps = 1/125 (0%)

Query: 14  KGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYTKE 73
           KG +++ EDD +R Y+ + G  NW  +  F    R  K CR RW N+L P +    +T E
Sbjct: 2   KGPFTEAEDDLIREYVKENGPQNWPRITSFLPN-RSPKQCRERWFNHLDPAVVKHAWTPE 60

Query: 74  EEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKKRKNKDPASSSSTQEHSYNN 133
           E++TI R   + G+KWS+IA  +PGRTDN IKN W++ + KR + +              
Sbjct: 61  EDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLPDRSKK 120

Query: 134 EETSQ 138
            + + 
Sbjct: 121 RKAAD 125


>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.98
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.89
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.87
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.78
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.76
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.74
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.74
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.74
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.73
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.73
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.71
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.71
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.71
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.7
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.69
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.67
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.66
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.66
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.66
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.65
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.64
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.63
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.62
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.6
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.6
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.6
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.6
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.59
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.56
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.55
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.54
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.31
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.54
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.49
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.49
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.47
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.46
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.46
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.45
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.45
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.39
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.09
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.38
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.37
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.36
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.36
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.35
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.33
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.29
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.24
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.09
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.03
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.01
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.89
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.88
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.86
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.76
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.68
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.68
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.57
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.55
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.51
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.44
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.42
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.33
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.57
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.24
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.15
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.06
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.05
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.96
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.91
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.74
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.69
2crg_A70 Metastasis associated protein MTA3; transcription 97.69
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.42
2crg_A70 Metastasis associated protein MTA3; transcription 97.36
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.34
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.29
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.24
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.97
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.86
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.67
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.52
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.82
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 94.5
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 93.86
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 92.63
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 91.33
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 91.32
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 80.71
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=100.00  E-value=6.4e-36  Score=232.19  Aligned_cols=104  Identities=41%  Similarity=0.847  Sum_probs=99.9

Q ss_pred             CCccCCCCHHHHHHHHHHHHHhCCCCcccccccccCccchhhhhhhhhcccCCCCCCCCCChHHHHHHHHHHHHhCCchH
Q 042846           11 GMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYTKEEEDTIIRLRQQHGNKWS   90 (243)
Q Consensus        11 ~lkKg~WT~EED~~L~~~V~~~g~~nW~~Ia~~l~~~Rt~kqcr~Rw~n~L~p~i~r~~WT~EED~~Ll~lv~~~G~~Ws   90 (243)
                      +++||+||+|||++|+.+|.+||..+|..||+.|+ +|+++||++||.++|+|.+++++||+|||++|+++|.+||++|+
T Consensus         1 ~l~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W~   79 (105)
T 1gv2_A            1 ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWA   79 (105)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCcHHHHhhhhc-CCCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCHH
Confidence            47899999999999999999999989999999998 99999999999999999999999999999999999999999999


Q ss_pred             HhhccCCCCCHHHHHHHHHHhhccc
Q 042846           91 LIAAKLPGRTDNEIKNYWHTHLKKR  115 (243)
Q Consensus        91 ~Ia~~lpgRT~~q~knrw~~~lkk~  115 (243)
                      .||+.|||||+++|++||+.+++++
T Consensus        80 ~Ia~~l~gRt~~~~k~rw~~~~~~~  104 (105)
T 1gv2_A           80 EIAKLLPGRTDNAIKNHWNSTMRRK  104 (105)
T ss_dssp             HHHTTCTTCCHHHHHHHHHHHTC--
T ss_pred             HHHHHcCCCCHHHHHHHHHHHHhcc
Confidence            9999999999999999999999875



>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-19
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-10
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 5e-18
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-09
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 5e-14
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 5e-07
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 9e-14
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-12
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-13
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 4e-06
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 3e-13
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 6e-09
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 9e-13
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 3e-12
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-10
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-06
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 1e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 2e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 5e-07
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 1e-08
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 0.002
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 8e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-07
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 75.9 bits (187), Expect = 4e-19
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 12 MKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNYLRPD 64
          + KG W+KEED +L   + KYG   W  + K     R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52


>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.77
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.77
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.73
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.72
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.7
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.64
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.62
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.6
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.55
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.55
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.54
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.53
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.53
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.51
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.42
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.41
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.4
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.38
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.35
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.32
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.31
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.25
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.21
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.19
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.07
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.04
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.87
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.22
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.1
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.93
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.93
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.52
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.3
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.66
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.51
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.29
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.04
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 94.43
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 92.34
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 88.54
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 81.92
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 80.44
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.77  E-value=1.7e-21  Score=145.30  Aligned_cols=71  Identities=17%  Similarity=0.209  Sum_probs=65.3

Q ss_pred             cCCCCHHHHHHHHHHHHHhCCC-----CcccccccccCccchhhhhhhhhcccCCCCCCCCCChHHHHHHHHHHHHh
Q 042846           14 KGAWSKEEDDKLRAYILKYGHW-----NWGELPKFAGLSRCGKSCRLRWMNYLRPDIKHGNYTKEEEDTIIRLRQQH   85 (243)
Q Consensus        14 Kg~WT~EED~~L~~~V~~~g~~-----nW~~Ia~~l~~~Rt~kqcr~Rw~n~L~p~i~r~~WT~EED~~Ll~lv~~~   85 (243)
                      ||+||+|||++|+++|.+||..     +|..||+.|+ |||++|||+||.++|+|.+++++||.+||.+|+..+..+
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lp-gRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~l   76 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVP-NHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNL   76 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTST-TSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCB
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcC-CCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhcc
Confidence            6899999999999999999864     4999999998 999999999999999999999999999999988765443



>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure