Citrus Sinensis ID: 042877

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
HGHHQHAPHSKSLSRDVRAARPKFYWERIPIMKRKGAETLQIAGSSLPDCSHACGSCSPCRLVMVSFVCASLEEAETCPMAYKCMCNNKSYPVP
cccccccccccccccHHHcccccCEEECccHHHcccccEEEEcccccccccccccccccccEEEEEEcccccccccccccEEEEcccccccccc
*********************PKFYWERIPIMKRKGAETLQIAGSSLPDCSHACGSCSPCRLVMVSFVCASLEEAETCPMAYKCMCNNKSYP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HGHHQHAPHSKSLSRDVRAARPKFYWERIPIMKRKGAETLQIAGSSLPDCSHACGSCSPCRLVMVSFVCASLEEAETCPMAYKCMCNNKSYPVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein EPIDERMAL PATTERNING FACTOR 1 Controls stomatal patterning. Regulates asymmetric cell division during guard cell differentiation. Mediates stomatal development inhibition.probableQ8S8I4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LIY, chain A
Confidence level:probable
Coverage over the Query: 43-87
View the alignment between query and template
View the model in PyMOL