Citrus Sinensis ID: 042895

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQLLKESSNFNKNFQLPAKSPSKVASMFSGPNKNVLLAVKQCPWEKVAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKHNFSQ
cccccccccccccccEEEEcEEEEEcccccccccccccccccccccccccccccEEEEcccHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccc
cccccccccccccccEEEEEEEEEEcccEEEcccEEEcccccEEEcccccccccEEEEcccHHHHHccccccccccccccccccHHHHHccccccccccccccccEEEEEEcccccccccEEEcccccEEcccccEccccEEEEcccccc
msfigtqqkckvcektvcpveqlstdgvvyhkscfkcsrckgtlklsnysslegvfyckphFEQLLKESSNfnknfqlpakspskvasmfsgpnkNVLLAVKQCPWEKVAAESQAShktcfkcsyagysispsnyAALEGILYCKHNFSQ
msfigtqqkckvceKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQLLKESSNFNKNFQLPAKSPSKVASMFSGPNKNVLLAVKQCPWEKVAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKHNFSQ
MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQLLKESSNFNKNFQLPAKSPSKVASMFSGPNKNVLLAVKQCPWEKVAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKHNFSQ
*****TQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQLLK***************************KNVLLAVKQCPWEKVAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKH****
**FIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQLLKESSNFNKNFQLPAKSPSKVASMFSGPNKNVLLAVKQCPWEKVAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKHNFS*
*********CKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQLLKESSNFNKNFQLPAKSPSKVASMFSGPNKNVLLAVKQCPWE**********KTCFKCSYAGYSISPSNYAALEGILYCKHNFSQ
*******QKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQLLKESSN***N*******************KNVLLAVKQCPWEKVAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKHN***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQLLKESSNFNKNFQLPAKSPSKVASMFSGPNKNVLLAVKQCPWEKVAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKHNFSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
P29675219 Pollen-specific protein S N/A no 0.993 0.680 0.444 4e-32
Q4U4S6 3784 Xin actin-binding repeat- yes no 0.5 0.019 0.466 2e-16
Q9BT23127 LIM domain-containing pro yes no 0.473 0.559 0.450 8e-15
Q1LZA7128 LIM domain-containing pro no no 0.466 0.546 0.457 8e-15
Q4KM31128 LIM domain-containing pro yes no 0.466 0.546 0.442 1e-14
Q8BGB5128 LIM domain-containing pro no no 0.466 0.546 0.428 2e-14
B0KYV5 756 LIM domain and actin-bind no no 0.453 0.089 0.471 2e-13
Q9ERG0 753 LIM domain and actin-bind no no 0.453 0.090 0.471 2e-13
Q9UHB6 759 LIM domain and actin-bind no no 0.453 0.089 0.471 2e-13
G3MWR8 1960 Protein-methionine sulfox no no 0.393 0.030 0.491 5e-11
>sp|P29675|SF3_HELAN Pollen-specific protein SF3 OS=Helianthus annuus GN=SF3 PE=2 SV=1 Back     alignment and function desciption
 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 95/162 (58%), Gaps = 13/162 (8%)

Query: 2   SFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPH 61
           SF GT QKC VCEKTV  V++L  +  VYHK+CF+C  C  TLKLSN++S +GV YC+ H
Sbjct: 3   SFTGTTQKCTVCEKTVYLVDKLVANQRVYHKACFRCHHCNSTLKLSNFNSFDGVVYCRHH 62

Query: 62  FEQLLKESSNFNKNFQLPAK------------SPSKVASMFSGPNKNVLLAVKQC-PWEK 108
           F+QL K + +  K+F    K            S ++++S F G         K   P E+
Sbjct: 63  FDQLFKRTGSLEKSFDGTPKFKPERTFSQETQSANRLSSFFEGTRDKCNACAKIVYPIER 122

Query: 109 VAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKHNFSQ 150
           V  +  A H+ CFKC + G +ISPSNY A EG LYCKH+  Q
Sbjct: 123 VKVDGTAYHRACFKCCHGGCTISPSNYIAHEGRLYCKHHHIQ 164
Could possibly involved in controlling pollen-specific processes such as male gamete maturation, pollen tube formation, or even fertilization.
Helianthus annuus (taxid: 4232)
>sp|Q4U4S6|XIRP2_MOUSE Xin actin-binding repeat-containing protein 2 OS=Mus musculus GN=Xirp2 PE=1 SV=1 Back     alignment and function description
>sp|Q9BT23|LIMD2_HUMAN LIM domain-containing protein 2 OS=Homo sapiens GN=LIMD2 PE=1 SV=1 Back     alignment and function description
>sp|Q1LZA7|LIMD2_BOVIN LIM domain-containing protein 2 OS=Bos taurus GN=LIMD2 PE=2 SV=1 Back     alignment and function description
>sp|Q4KM31|LIMD2_RAT LIM domain-containing protein 2 OS=Rattus norvegicus GN=Limd2 PE=2 SV=1 Back     alignment and function description
>sp|Q8BGB5|LIMD2_MOUSE LIM domain-containing protein 2 OS=Mus musculus GN=Limd2 PE=2 SV=1 Back     alignment and function description
>sp|B0KYV5|LIMA1_PIG LIM domain and actin-binding protein 1 OS=Sus scrofa GN=LIMA1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ERG0|LIMA1_MOUSE LIM domain and actin-binding protein 1 OS=Mus musculus GN=Lima1 PE=1 SV=3 Back     alignment and function description
>sp|Q9UHB6|LIMA1_HUMAN LIM domain and actin-binding protein 1 OS=Homo sapiens GN=LIMA1 PE=1 SV=1 Back     alignment and function description
>sp|G3MWR8|MICA3_BOVIN Protein-methionine sulfoxide oxidase MICAL3 OS=Bos taurus GN=MICAL3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
225449230189 PREDICTED: pollen-specific protein SF3 i 1.0 0.793 0.716 1e-55
449441328189 PREDICTED: pollen-specific protein SF3-l 1.0 0.793 0.703 2e-55
255579126189 Pollen-specific protein SF3, putative [R 1.0 0.793 0.697 4e-54
356539923200 PREDICTED: pollen-specific protein SF3-l 1.0 0.75 0.679 7e-54
224109388189 predicted protein [Populus trichocarpa] 1.0 0.793 0.679 8e-54
260619528189 LIM1 [Hevea brasiliensis] 1.0 0.793 0.691 9e-54
224101093189 predicted protein [Populus trichocarpa] 1.0 0.793 0.679 9e-54
118485508189 unknown [Populus trichocarpa] 1.0 0.793 0.679 1e-53
449465043195 PREDICTED: pollen-specific protein SF3-l 1.0 0.769 0.679 1e-53
359807240198 uncharacterized protein LOC100809121 [Gl 1.0 0.757 0.672 2e-53
>gi|225449230|ref|XP_002279922.1| PREDICTED: pollen-specific protein SF3 isoform 1 [Vitis vinifera] gi|147859521|emb|CAN81425.1| hypothetical protein VITISV_014590 [Vitis vinifera] gi|296086105|emb|CBI31546.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 116/162 (71%), Positives = 122/162 (75%), Gaps = 12/162 (7%)

Query: 1   MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKP 60
           MSFIGTQQKCK C KTV PVEQLS DGVVYHKSCFKCS C GTLKLSNYSS+EGV YCKP
Sbjct: 1   MSFIGTQQKCKACLKTVYPVEQLSADGVVYHKSCFKCSHCNGTLKLSNYSSMEGVLYCKP 60

Query: 61  HFEQLLKESSNFNKNFQLPAK-----------SPSKVASMFSGPNKNVLLAVKQC-PWEK 108
           HFEQL KES NFNKNFQ PAK           SPSK ASMFSG  +      K   P EK
Sbjct: 61  HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK 120

Query: 109 VAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKHNFSQ 150
           V  ESQA HK+CFKCS+ G  ISPSNYAALEGILYCKH+F+Q
Sbjct: 121 VTVESQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQ 162

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449441328|ref|XP_004138434.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus] gi|449516649|ref|XP_004165359.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255579126|ref|XP_002530411.1| Pollen-specific protein SF3, putative [Ricinus communis] gi|223530060|gb|EEF31981.1| Pollen-specific protein SF3, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356539923|ref|XP_003538442.1| PREDICTED: pollen-specific protein SF3-like isoform 1 [Glycine max] gi|356539925|ref|XP_003538443.1| PREDICTED: pollen-specific protein SF3-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|224109388|ref|XP_002315180.1| predicted protein [Populus trichocarpa] gi|118488763|gb|ABK96192.1| unknown [Populus trichocarpa] gi|222864220|gb|EEF01351.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|260619528|gb|ACX47456.1| LIM1 [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|224101093|ref|XP_002312139.1| predicted protein [Populus trichocarpa] gi|118485190|gb|ABK94456.1| unknown [Populus trichocarpa] gi|222851959|gb|EEE89506.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118485508|gb|ABK94608.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449465043|ref|XP_004150238.1| PREDICTED: pollen-specific protein SF3-like isoform 1 [Cucumis sativus] gi|449465045|ref|XP_004150239.1| PREDICTED: pollen-specific protein SF3-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|359807240|ref|NP_001241110.1| uncharacterized protein LOC100809121 [Glycine max] gi|255646260|gb|ACU23614.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
TAIR|locus:2061171200 WLIM2a "WLIM2a" [Arabidopsis t 1.0 0.75 0.625 1.7e-50
TAIR|locus:2198210205 PLIM2b "PLIM2b" [Arabidopsis t 0.993 0.726 0.515 2.5e-42
TAIR|locus:2050735226 PLIM2a "PLIM2a" [Arabidopsis t 1.0 0.663 0.512 3.6e-41
TAIR|locus:2098871213 PLIM2c "PLIM2c" [Arabidopsis t 0.993 0.699 0.484 2.9e-39
TAIR|locus:2012798190 WLIM1 "AT1G10200" [Arabidopsis 1.0 0.789 0.475 2.7e-36
DICTYBASE|DDB_G0290575 472 DDB_G0290575 "LIM-type zinc fi 0.48 0.152 0.5 3.1e-22
UNIPROTKB|F1NLB6146 LIMD2 "Uncharacterized protein 0.6 0.616 0.4 4.1e-17
UNIPROTKB|E1C059128 LIMD2 "Uncharacterized protein 0.466 0.546 0.471 1.1e-16
UNIPROTKB|E2RGH6128 LIMD2 "Uncharacterized protein 0.466 0.546 0.457 1.1e-16
UNIPROTKB|Q1LZA7128 LIMD2 "LIM domain-containing p 0.466 0.546 0.457 1.4e-16
TAIR|locus:2061171 WLIM2a "WLIM2a" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 525 (189.9 bits), Expect = 1.7e-50, P = 1.7e-50
 Identities = 102/163 (62%), Positives = 117/163 (71%)

Query:     1 MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKP 60
             MSF GTQQKC+ CEKTV PVE LS DG+ YHK+CFKCS CK  L+LSNYSS+EGV YC+P
Sbjct:     1 MSFTGTQQKCRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRP 60

Query:    61 HFEQLLKESSNFNKNFQLPAK------------SPSKVASMFSGPNKNVLLAVKQC-PWE 107
             HFEQL KES +F+KNFQ PAK            +PS++A MFSG         K   P E
Sbjct:    61 HFEQLFKESGSFSKNFQSPAKPLTDKPTPELNRTPSRLAGMFSGTQDKCATCTKTVYPIE 120

Query:   108 KVAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKHNFSQ 150
             KV  ESQ  HK+CFKCS+ G  ISPSNYAALEGILYCKH+F+Q
Sbjct:   121 KVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQ 163
GO:0008270 "zinc ion binding" evidence=IEA
GO:0051015 "actin filament binding" evidence=IDA
GO:0051017 "actin filament bundle assembly" evidence=IDA
GO:0000271 "polysaccharide biosynthetic process" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0009825 "multidimensional cell growth" evidence=RCA
GO:0009932 "cell tip growth" evidence=RCA
GO:0010817 "regulation of hormone levels" evidence=RCA
GO:0043481 "anthocyanin accumulation in tissues in response to UV light" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
TAIR|locus:2198210 PLIM2b "PLIM2b" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050735 PLIM2a "PLIM2a" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098871 PLIM2c "PLIM2c" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012798 WLIM1 "AT1G10200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290575 DDB_G0290575 "LIM-type zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLB6 LIMD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C059 LIMD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGH6 LIMD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZA7 LIMD2 "LIM domain-containing protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
cd0944063 cd09440, LIM1_SF3, The first Lim domain of pollen 1e-34
cd0935853 cd09358, LIM_Mical_like, The LIM domain of Mical ( 4e-22
cd0944161 cd09441, LIM2_SF3, The second Lim domain of pollen 7e-18
cd0944161 cd09441, LIM2_SF3, The second Lim domain of pollen 4e-16
cd0944253 cd09442, LIM_Eplin_like, The Lim domain of Epithel 6e-16
cd0944553 cd09445, LIM_Mical_like_2, This domain belongs to 1e-14
cd0943955 cd09439, LIM_Mical, The LIM domain of Mical (molec 2e-13
cd0948553 cd09485, LIM_Eplin_alpha_beta, The Lim domain of E 3e-13
cd0948653 cd09486, LIM_Eplin_like_1, a LIM domain subfamily 6e-13
cd0944753 cd09447, LIM_LASP, The LIM domain of LIM and SH3 P 5e-10
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 5e-09
cd0944063 cd09440, LIM1_SF3, The first Lim domain of pollen 1e-08
cd0935853 cd09358, LIM_Mical_like, The LIM domain of Mical ( 3e-08
cd0944355 cd09443, LIM_Ltd-1, The LIM domain of LIM and tran 8e-08
pfam0041258 pfam00412, LIM, LIM domain 1e-07
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 4e-07
cd0944455 cd09444, LIM_Mical_like_1, This domain belongs to 4e-07
cd0940454 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84 2e-06
cd0940061 cd09400, LIM_like_1, LIM domain in proteins of unk 2e-06
cd0932653 cd09326, LIM_CRP_like, The LIM domains of Cysteine 3e-06
cd0944253 cd09442, LIM_Eplin_like, The Lim domain of Epithel 4e-06
cd0940153 cd09401, LIM_TLP_like, The LIM domains of thymus L 4e-06
cd0948553 cd09485, LIM_Eplin_alpha_beta, The Lim domain of E 5e-06
cd0935953 cd09359, LIM_LASP_like, The LIM domain of LIM and 1e-05
cd0940354 cd09403, LIM2_CRP, The second LIM domain of Cystei 3e-05
cd0944653 cd09446, LIM_N_RAP, The LIM domain of N-RAP 5e-05
cd0948254 cd09482, LIM2_CRP3, The second LIM domain of Cyste 6e-05
cd0948154 cd09481, LIM1_CRP3, The first LIM domain of Cystei 8e-05
cd0944553 cd09445, LIM_Mical_like_2, This domain belongs to 1e-04
cd0940253 cd09402, LIM1_CRP, The first LIM domain of Cystein 1e-04
cd0947956 cd09479, LIM1_CRP1, The first LIM domain of Cystei 1e-04
cd0984054 cd09840, LIM2_CRP2, The second LIM domain of Cyste 4e-04
cd0948254 cd09482, LIM2_CRP3, The second LIM domain of Cyste 6e-04
cd0947754 cd09477, LIM2_TLP, The second LIM domain of thymus 0.001
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 0.001
cd0947654 cd09476, LIM1_TLP, The first LIM domain of thymus 0.001
cd0943955 cd09439, LIM_Mical, The LIM domain of Mical (molec 0.002
cd0942758 cd09427, LIM2_FHL3, The second LIM domain of Four 0.002
cd0948055 cd09480, LIM1_CRP2, The first LIM domain of Cystei 0.003
cd0948653 cd09486, LIM_Eplin_like_1, a LIM domain subfamily 0.004
>gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein SF3 Back     alignment and domain information 
 Score =  114 bits (288), Expect = 1e-34
 Identities = 51/63 (80%), Positives = 55/63 (87%)

Query: 6  TQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQL 65
          T QKCK C+KTV  V+QLS DGVVYHKSCF+CS CKGTLKLSNYSS+EGV YCKPHFEQL
Sbjct: 1  TTQKCKACDKTVYLVDQLSADGVVYHKSCFRCSHCKGTLKLSNYSSMEGVLYCKPHFEQL 60

Query: 66 LKE 68
           KE
Sbjct: 61 FKE 63

The first Lim domain of pollen specific protein SF3: SF3 is a Lim protein that is found exclusively in mature plant pollen grains. It contains two LIM domains. The exact function of SF3 is unknown. It may be a transcription factor required for the expression of late pollen genes. It is possible that SF3 protein is involved in controlling pollen-specific processes such as male gamete maturation, pollen tube formation, or even fertilization. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein. Length = 63
>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family Back     alignment and domain information
>gnl|CDD|188825 cd09441, LIM2_SF3, The second Lim domain of pollen specific protein SF3 Back     alignment and domain information
>gnl|CDD|188825 cd09441, LIM2_SF3, The second Lim domain of pollen specific protein SF3 Back     alignment and domain information
>gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) like proteins Back     alignment and domain information
>gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins Back     alignment and domain information
>gnl|CDD|188823 cd09439, LIM_Mical, The LIM domain of Mical (molecule interacting with CasL) Back     alignment and domain information
>gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) Back     alignment and domain information
>gnl|CDD|188870 cd09486, LIM_Eplin_like_1, a LIM domain subfamily on a group of proteins with unknown function Back     alignment and domain information
>gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP) Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein SF3 Back     alignment and domain information
>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family Back     alignment and domain information
>gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase domains protein (Ltd-1) Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188828 cd09444, LIM_Mical_like_1, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins Back     alignment and domain information
>gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A Back     alignment and domain information
>gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function Back     alignment and domain information
>gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family Back     alignment and domain information
>gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) like proteins Back     alignment and domain information
>gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) Back     alignment and domain information
>gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins Back     alignment and domain information
>gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) Back     alignment and domain information
>gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP Back     alignment and domain information
>gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) Back     alignment and domain information
>gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) Back     alignment and domain information
>gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins Back     alignment and domain information
>gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein (CRP) Back     alignment and domain information
>gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) Back     alignment and domain information
>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) Back     alignment and domain information
>gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188823 cd09439, LIM_Mical, The LIM domain of Mical (molecule interacting with CasL) Back     alignment and domain information
>gnl|CDD|188811 cd09427, LIM2_FHL3, The second LIM domain of Four and a half LIM domains protein 3 (FHL3) Back     alignment and domain information
>gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|188870 cd09486, LIM_Eplin_like_1, a LIM domain subfamily on a group of proteins with unknown function Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
KOG1701468 consensus Focal adhesion adaptor protein Paxillin 99.92
KOG1701468 consensus Focal adhesion adaptor protein Paxillin 99.89
KOG4577 383 consensus Transcription factor LIM3, contains LIM 99.88
KOG2272332 consensus Focal adhesion protein PINCH-1, contains 99.87
KOG1700200 consensus Regulatory protein MLP and related LIM p 99.81
KOG1703479 consensus Adaptor protein Enigma and related PDZ-L 99.79
KOG1703479 consensus Adaptor protein Enigma and related PDZ-L 99.79
KOG2272 332 consensus Focal adhesion protein PINCH-1, contains 99.78
KOG1044 670 consensus Actin-binding LIM Zn-finger protein Lima 99.78
KOG1044 670 consensus Actin-binding LIM Zn-finger protein Lima 99.77
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.6
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.56
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.86
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.83
KOG4577 383 consensus Transcription factor LIM3, contains LIM 98.72
KOG1700200 consensus Regulatory protein MLP and related LIM p 98.54
KOG1702 264 consensus Nebulin repeat protein [Cytoskeleton] 98.32
KOG1702 264 consensus Nebulin repeat protein [Cytoskeleton] 98.1
KOG0490 235 consensus Transcription factor, contains HOX domai 97.94
KOG0490 235 consensus Transcription factor, contains HOX domai 92.1
PF09943101 DUF2175: Uncharacterized protein conserved in arch 89.7
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 88.64
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 87.05
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 85.55
PF0839437 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: 84.73
PF0206952 Metallothio_Pro: Prokaryotic metallothionein; Inte 83.72
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 83.5
PF09943101 DUF2175: Uncharacterized protein conserved in arch 83.23
PF1324023 zinc_ribbon_2: zinc-ribbon domain 83.0
PF1178136 RRN7: RNA polymerase I-specific transcription init 81.76
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] Back     alignment and domain information 
Probab=99.92  E-value=4.4e-27  Score=178.32  Aligned_cols=113  Identities=21%  Similarity=0.479  Sum_probs=105.0

Q ss_pred             ccccccCceeeccc-eEEeCCcccccCCcccccccccCCCCCccccCCeeecCchhhhhhccccccCCCCCCCCCCCccc
Q 042895            8 QKCKVCEKTVCPVE-QLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQLLKESSNFNKNFQLPAKSPSKV   86 (150)
Q Consensus         8 ~~C~~C~~~I~~~~-~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~~~~~~~~~~~~~~~~~~   86 (150)
                      .+|++|+|.|...+ .+.++++.||..||+|..|++.|....|+.+++++||+.||++.+                    
T Consensus       275 ~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tl--------------------  334 (468)
T KOG1701|consen  275 GICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTL--------------------  334 (468)
T ss_pred             hhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHH--------------------
Confidence            48999999998555 579999999999999999999999999999999999999999877                    


Q ss_pred             cccCCCCCCcCCcccceeccceeeeCCccccccccccccCCcccCCCCcccc-CCcccccccc
Q 042895           87 ASMFSGPNKNVLLAVKQCPWEKVAAESQASHKTCFKCSYAGYSISPSNYAAL-EGILYCKHNF  148 (150)
Q Consensus        87 ~~~~~~~~~~C~~C~~i~~~~~v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~-~g~~yC~~cy  148 (150)
                              ++|..|+++|....|.|+|+.||+.||+|..|++-|++..|+.. ++++||..||
T Consensus       335 --------ekC~~Cg~~I~d~iLrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~df  389 (468)
T KOG1701|consen  335 --------EKCNKCGEPIMDRILRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDF  389 (468)
T ss_pred             --------HHHhhhhhHHHHHHHHhcccccCCCceEEEEeccccCCccccccCCCceeeehhh
Confidence                    68999999777778999999999999999999999999999985 9999999998

>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1700 consensus Regulatory protein MLP and related LIM proteins [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1703 consensus Adaptor protein Enigma and related PDZ-LIM proteins [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1703 consensus Adaptor protein Enigma and related PDZ-LIM proteins [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1044 consensus Actin-binding LIM Zn-finger protein Limatin involved in axon guidance [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1044 consensus Actin-binding LIM Zn-finger protein Limatin involved in axon guidance [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG1700 consensus Regulatory protein MLP and related LIM proteins [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1702 consensus Nebulin repeat protein [Cytoskeleton] Back     alignment and domain information
>KOG1702 consensus Nebulin repeat protein [Cytoskeleton] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators Back     alignment and domain information
>PF02069 Metallothio_Pro: Prokaryotic metallothionein; InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
2d8y_A91 Solution Structure Of The Lim Domain Of Epithelial 1e-14
2d8y_A91 Solution Structure Of The Lim Domain Of Epithelial 9e-06
1b8t_A192 Solution Structure Of The Chicken Crp1 Length = 192 2e-08
1cxx_A113 Mutant R122a Of Quail Cysteine And Glycine-Rich Pro 2e-05
1qli_A113 Quail Cysteine And Glycine-Rich Protein, Nmr, 15 Mi 3e-05
2co8_A82 Solution Structures Of The Lim Domain Of Human Nedd 6e-05
2o10_A60 Solution Structure Of The N-Terminal Lim Domain Of 6e-05
1ctl_A85 Structure Of The Carboxy-Terminal Lim Domain From T 1e-04
2o13_A58 Solution Structure Of The C-Terminal Lim Domain Of 2e-04
2cu8_A76 Solution Structure Of The Lim Domain Of Human Cyste 3e-04
>pdb|2D8Y|A Chain A, Solution Structure Of The Lim Domain Of Epithelial Protein Lost In Neoplasm Length = 91 Back     alignment and structure 
Iteration: 1

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%)
Query: 6  TQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQL 65
           ++ C  C+KTV P+E+L  +  V+H SCF+CS C   L L  Y+SL G  YCKPHF QL
Sbjct: 14 ARETCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQL 73
Query: 66 LKESSNFNKNF 76
           K   N+++ F
Sbjct: 74 FKSKGNYDEGF 84
>pdb|2D8Y|A Chain A, Solution Structure Of The Lim Domain Of Epithelial Protein Lost In Neoplasm Length = 91 Back     alignment and structure
>pdb|1B8T|A Chain A, Solution Structure Of The Chicken Crp1 Length = 192 Back     alignment and structure
>pdb|1CXX|A Chain A, Mutant R122a Of Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Structure Length = 113 Back     alignment and structure
>pdb|1QLI|A Chain A, Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Average Structure Length = 113 Back     alignment and structure
>pdb|2CO8|A Chain A, Solution Structures Of The Lim Domain Of Human Nedd9 Interacting Protein With Calponin Homology And Lim Domains Length = 82 Back     alignment and structure
>pdb|2O10|A Chain A, Solution Structure Of The N-Terminal Lim Domain Of MlpCRP3 Length = 60 Back     alignment and structure
>pdb|1CTL|A Chain A, Structure Of The Carboxy-Terminal Lim Domain From The Cysteine Rich Protein Crp Length = 85 Back     alignment and structure
>pdb|2O13|A Chain A, Solution Structure Of The C-Terminal Lim Domain Of MlpCRP3 Length = 58 Back     alignment and structure
>pdb|2CU8|A Chain A, Solution Structure Of The Lim Domain Of Human Cysteine-Rich Protein 2 Length = 76 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 9e-25
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 1e-13
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 2e-24
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 1e-06
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 2e-21
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 9e-07
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 1e-19
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 2e-05
2co8_A82 NEDD9 interacting protein with calponin homology a 1e-19
2co8_A82 NEDD9 interacting protein with calponin homology a 5e-05
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 8e-17
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-06
3f6q_B72 LIM and senescent cell antigen-like-containing dom 5e-14
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 3e-12
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 8e-09
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 9e-09
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 1e-08
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 2e-08
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 3e-07
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 1e-06
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 8e-04
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 3e-06
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 3e-06
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 4e-06
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 3e-05
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 4e-06
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 4e-06
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 4e-06
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 6e-06
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 9e-06
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 1e-05
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 2e-05
2cuq_A80 Four and A half LIM domains 3; structural genomics 2e-05
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 2e-05
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 2e-05
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 3e-05
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 3e-05
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 4e-05
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 9e-05
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 9e-05
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 9e-05
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 1e-04
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 1e-04
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 3e-04
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 3e-04
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
 Score = 93.2 bits (231), Expect = 9e-25
 Identities = 37/172 (21%), Positives = 61/172 (35%), Gaps = 22/172 (12%)

Query: 1   MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKP 60
           M   G  +KC VC+K V   E++  +G  +HKSCF C  CK  L  +  +      YCK 
Sbjct: 1   MPNWGGGKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDEIYCKS 60

Query: 61  HFEQLLKESSNFNKNFQLPAKSPSKVASMFSGPNKNVLLAVKQC---------------- 104
            + +                 +    +                                 
Sbjct: 61  CYGKKYGPKGKGKGMGAGTLSTDKGESLGIKYEEGQSHRPTNPNASRMAQKVGGSDGCPR 120

Query: 105 ------PWEKVAAESQASHKTCFKCSYAGYSISPSNYAALEGILYCKHNFSQ 150
                   EKV    ++ HK+CF+C+  G S+  +  A  +G +YCK  +++
Sbjct: 121 CGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLADKDGEIYCKGCYAK 172
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.98
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.97
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.97
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.97
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.96
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.96
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.94
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.91
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.88
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.82
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.82
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.82
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.81
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.8
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.77
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.77
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.77
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.76
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.74
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.74
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.73
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.72
2co8_A82 NEDD9 interacting protein with calponin homology a 99.7
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.69
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.69
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.69
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.69
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.68
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.68
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.67
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.67
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.67
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.67
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.67
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.66
2co8_A82 NEDD9 interacting protein with calponin homology a 99.66
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.66
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.65
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.65
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.64
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.64
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.64
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.64
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.64
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.64
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.64
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.64
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.64
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.64
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.64
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.63
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.63
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.62
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.62
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.62
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.62
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.62
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.61
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.61
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.6
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.6
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.59
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.59
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.59
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.59
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.58
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.58
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.58
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.57
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.57
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.56
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.56
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.56
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.55
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.53
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.53
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.51
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.5
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.48
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.45
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.42
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.41
2rgt_A 169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.38
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.34
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 98.59
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 98.49
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 92.38
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 88.22
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 83.98
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 81.64
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 81.3
1jjd_A55 Metallothionein, SMTA; zinc finger, zinc cluster, 80.6
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
Probab=99.98  E-value=4.1e-33  Score=197.31  Aligned_cols=148  Identities=28%  Similarity=0.522  Sum_probs=121.0

Q ss_pred             CCCCCCcccccccCceeeccceEEeCCcccccCCcccccccccCCCCCccccCCeeecCchhhhhhcccccc-CCCCCCC
Q 042895            1 MSFIGTQQKCKVCEKTVCPVEQLSTDGVVYHKSCFKCSRCKGTLKLSNYSSLEGVFYCKPHFEQLLKESSNF-NKNFQLP   79 (150)
Q Consensus         1 ~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~c~~~~~~~~~~~-~~~~~~~   79 (150)
                      |+..++.++|.+|+++|.+++.+.++++.||++||+|..|+++|....|+.++|++||+.||.+++++++.. ....+..
T Consensus         1 m~~~~~~~~C~~C~~~I~~~~~v~a~g~~wH~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~f~~~c~~c~~~~g~~   80 (192)
T 1b8t_A            1 MPNWGGGKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGPKGKGKGMGAGTL   80 (192)
T ss_dssp             CCCCCCCEECTTTCCEECSSCCEEETTEEECTTTCBCTTTCCBCCSSSEEEETTEEEEHHHHHHHHSCCCCCCCCCCCCC
T ss_pred             CCCCCCCCcCccCCCeecceeEEEeCCceecCCCCcCcccCCcCCCCeeEecCCEeeChhhhHhhcCccccccccccccE
Confidence            888999999999999998888889999999999999999999999988999999999999999999987531 1000000


Q ss_pred             ----------------CCCC-----ccccccCCCCCCcCCcccc-eeccceeeeCCccccccccccccCCcccCCCCccc
Q 042895           80 ----------------AKSP-----SKVASMFSGPNKNVLLAVK-QCPWEKVAAESQASHKTCFKCSYAGYSISPSNYAA  137 (150)
Q Consensus        80 ----------------~~~~-----~~~~~~~~~~~~~C~~C~~-i~~~~~v~~~~~~~H~~Cf~C~~C~~~l~~~~~~~  137 (150)
                                      +..|     ...... .++.++|++|++ |.+++.|.++++.||++||+|..|+++|.++.|+.
T Consensus        81 ~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~-~~~~~~C~~C~~~I~~~~~v~a~~~~~H~~CF~C~~C~~~L~~~~~~~  159 (192)
T 1b8t_A           81 STDKGESLGIKYEEGQSHRPTNPNASRMAQK-VGGSDGCPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLAD  159 (192)
T ss_dssp             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCEECTTTSCEECSSSCEEETTEEECTTTCBCTTTCCBCCSSSEEE
T ss_pred             ecCCCcccccccccccccCCCCcCccccccc-cCCCCcCCCCCCEecCcEEEecCCCccchhcCCccccCCCCCCCcccc
Confidence                            0011     011111 133578999999 76788899999999999999999999998888999


Q ss_pred             cCCccccccccC
Q 042895          138 LEGILYCKHNFS  149 (150)
Q Consensus       138 ~~g~~yC~~cy~  149 (150)
                      .+|++||+.||.
T Consensus       160 ~~g~~yC~~cy~  171 (192)
T 1b8t_A          160 KDGEIYCKGCYA  171 (192)
T ss_dssp             ETTEEEEHHHHH
T ss_pred             cCCEEeCHHHHH
Confidence            999999999984
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1jjd_A Metallothionein, SMTA; zinc finger, zinc cluster, metal binding PR; NMR {Synechococcus elongatus} SCOP: g.46.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d2d8ya242 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapie 2e-14
d2d8ya242 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapie 2e-05
d2co8a236 g.39.1.3 (A:8-43) Nedd9 interacting protein with c 1e-09
d2d8ya135 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapien 6e-09
d1b8ta343 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) pr 9e-08
d1b8ta135 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) prote 0.002
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Eplin, LIMA1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 61.2 bits (149), Expect = 2e-14
 Identities = 20/41 (48%), Positives = 25/41 (60%)

Query: 36 KCSRCKGTLKLSNYSSLEGVFYCKPHFEQLLKESSNFNKNF 76
          +CS C   L L  Y+SL G  YCKPHF QL K   N+++ F
Sbjct: 1  RCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDEGF 41
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 43 Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 99.19
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 99.02
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.95
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.92
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.9
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.82
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.73
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.72
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.69
d2co8a236 Nedd9 interacting protein with calponin homology, 98.69
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.64
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.63
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.62
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.62
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.61
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 98.59
d2co8a236 Nedd9 interacting protein with calponin homology, 98.57
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.57
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.56
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.56
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.55
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.55
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.54
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 98.53
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 98.52
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.5
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.49
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.47
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.46
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.46
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.44
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 98.43
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.38
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 98.37
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.37
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.34
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.34
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.34
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.33
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.33
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.28
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.27
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 98.27
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 98.25
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.25
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.24
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.21
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.2
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.2
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 98.17
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.15
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.14
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.14
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.1
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.09
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.08
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 98.08
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.05
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 98.03
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.02
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.01
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 98.0
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.98
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.98
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.97
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.97
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.95
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.93
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.93
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 97.92
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.9
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.88
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.78
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.76
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.69
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.68
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.66
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.65
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.59
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.55
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.55
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.54
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.54
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.53
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.51
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.51
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.5
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.46
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.44
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.41
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.41
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.36
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.35
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.31
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.28
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.16
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.07
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 97.06
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.97
d2cora235 Pinch (particularly interesting new Cys-His) prote 96.87
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.71
d1g47a135 Pinch (particularly interesting new Cys-His) prote 96.46
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.46
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 96.37
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.21
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 96.11
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 95.92
d2co8a133 Nedd9 interacting protein with calponin homology, 95.79
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 95.68
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 95.46
d1g47a135 Pinch (particularly interesting new Cys-His) prote 95.24
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 95.08
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 95.05
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.04
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.03
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 94.81
d2cora131 Pinch (particularly interesting new Cys-His) prote 94.74
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 94.74
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 94.62
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 93.6
d2cora235 Pinch (particularly interesting new Cys-His) prote 93.31
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 89.68
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 89.34
d1j2oa233 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 87.65
d2gvia233 Uncharacterized protein Ta1109 {Thermoplasma acido 83.41
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 82.7
d1x4la230 Four and a half LIM domains protein 2, FHL2 {Human 81.9
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Leupaxin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.19  E-value=2e-12  Score=64.43  Aligned_cols=27  Identities=15%  Similarity=0.111  Sum_probs=26.0

Q ss_pred             CcCCcccceeccceeeeCCcccccccc
Q 042895           95 KNVLLAVKQCPWEKVAAESQASHKTCF  121 (150)
Q Consensus        95 ~~C~~C~~i~~~~~v~~~~~~~H~~Cf  121 (150)
                      ++|.+|+++|.++.|+|+|+.||++||
T Consensus         9 pkC~~C~~~I~g~~v~Al~~~wHpeCF   35 (35)
T d1x3ha1           9 PKCGGCNRPVLENYLSAMDTVWHPECF   35 (35)
T ss_dssp             CBCTTTCCBCCSSCEEETTEEECTTTC
T ss_pred             hhhhhcCCcccchheeecCCccCcccC
Confidence            999999998889999999999999998
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gvia2 g.39.1.18 (A:169-201) Uncharacterized protein Ta1109 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure