Citrus Sinensis ID: 042904

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320

MGGVGDDTLSEYFFDEGETNLAEDDLFAIFESLDSVTPLDEAATAVSEARLVSQKSTSSSILQESDETDQLTETLPKNKRQKTAATSAVNSSDEANNTDGQQRMSHITVERNRRKQMNENLSVLRSLMPCFYVKRGDQASIIGGVVDYINELQQVLQSLEAKKQRKVYCEVLSPRLVSSPRPSPLSPRKPPLSPRLNLPISPRTPQPGSPYKPRLQQQGYLSPTKATNNNSVEPSPCSSSTSSIDSINELVANSKSAIADVEVKFSGPNLLLKTVSPRIPGQAVKIISALEDLAFEILHVNISTVDETMHNSFTIKVTKL

cccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccEEEccccEEEEEEccccccHHHHHHHHHHHcccEEEEEEEEccccEEEEEEEEEEEEc

*******TLSEYFFDEGETNLAEDDLFAIFESLDSV**************************************************************************RNRRKQMNENLSVLRSLMPCFYVKRGDQASIIGGVVDYINELQQVLQSLEAKKQR***************************************************************************************NSKSAIADVEVKFSGPNLLLKTVSPRIPGQAVKIISALEDLAFEILHVNISTVDETMHNSFTIKVTKL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGGVGDDTLSEYFFDEGETNLAEDDLFAIFESLDSVTPLDEAATAVSEARLVSQKSTSSSILQESDETDQLTETLPKNKRQKTAATSAVNSSDEANNTDGQQRMSHITVERNRRKQMNENLSVLRSLMPCFYVKRGDQASIIGGxxxxxxxxxxxxxxxxxxxxxKVYCEVLSPRLVSSPRPSPLSPRKPPLSPRLNLPISPRTPQPGSPYKPRLQQQGYLSPTKATNNNSVEPSPCSSSTSSIDSINELVANSKSAIADVEVKFSGPNLLLKTVSPRIPGQAVKIISALEDLAFEILHVNISTVDETMHNSFTIKVTKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor SPEECHLESS	Transcription factor. Together with FMA and MUTE, regulates the stomata formation. Required for the initiation and the formation of stomata, by promoting the first asymmetric cell divisions.	probable	Q700C7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HLO, chain A
Confidence level:confident
Coverage over the Query: 99-167
View the alignment between query and template
View the model in PyMOL

Template: 1ZPV, chain A
Confidence level:probable
Coverage over the Query: 269-318
View the alignment between query and template
View the model in PyMOL