Citrus Sinensis ID: 042904
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 320 | ||||||
| 255545056 | 336 | DNA binding protein, putative [Ricinus c | 0.937 | 0.892 | 0.744 | 1e-111 | |
| 224118162 | 323 | predicted protein [Populus trichocarpa] | 0.918 | 0.910 | 0.745 | 1e-104 | |
| 356518615 | 349 | PREDICTED: transcription factor SPEECHLE | 0.95 | 0.871 | 0.687 | 1e-102 | |
| 356509301 | 344 | PREDICTED: transcription factor SPEECHLE | 0.943 | 0.877 | 0.693 | 1e-101 | |
| 225462721 | 338 | PREDICTED: transcription factor SPEECHLE | 0.931 | 0.881 | 0.685 | 3e-96 | |
| 357463825 | 329 | Transcription factor SPEECHLESS [Medicag | 0.925 | 0.899 | 0.691 | 1e-94 | |
| 224116902 | 303 | predicted protein [Populus trichocarpa] | 0.837 | 0.884 | 0.678 | 2e-93 | |
| 449463493 | 376 | PREDICTED: transcription factor SPEECHLE | 0.928 | 0.789 | 0.585 | 2e-93 | |
| 356546430 | 328 | PREDICTED: transcription factor SPEECHLE | 0.915 | 0.893 | 0.638 | 2e-89 | |
| 312282859 | 368 | unnamed protein product [Thellungiella h | 0.915 | 0.796 | 0.546 | 9e-84 |
| >gi|255545056|ref|XP_002513589.1| DNA binding protein, putative [Ricinus communis] gi|223547497|gb|EEF48992.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 406 bits (1043), Expect = e-111, Method: Compositional matrix adjust.
Identities = 242/325 (74%), Positives = 269/325 (82%), Gaps = 25/325 (7%)
Query: 7 DTLSEYFFDE--GETNLAEDDLFAIFESLDSVT------PLDEAATAVSEA-----RLVS 53
D++S++F + G+ L +DLFAIFE+LDSVT P +E + RLVS
Sbjct: 3 DSVSDFFEEHEFGDNTLDGEDLFAIFETLDSVTQFPPVTPSNEVVVISKDGGEETTRLVS 62
Query: 54 QKSTSSSILQESDETDQLTETLPKNKRQKTAATSAVNSSDEANNTDGQQRMSHITVERNR 113
QKSTSSS + ES ET+ ET PKNKRQKT S+ E N DGQQRMSHITVERNR
Sbjct: 63 QKSTSSSAILES-ETE--LETSPKNKRQKTGIASS-----EEINPDGQQRMSHITVERNR 114
Query: 114 RKQMNENLSVLRSLMPCFYVKRGDQASIIGGVVDYINELQQVLQSLEAKKQRKVYCEVLS 173
RKQMNE+LSVLRSLMPCFYVKRGDQASIIGGVV+YINELQQVLQ+LEAKKQRKVY EVLS
Sbjct: 115 RKQMNEHLSVLRSLMPCFYVKRGDQASIIGGVVNYINELQQVLQALEAKKQRKVYSEVLS 174
Query: 174 PRLVSSPRPSPLSPRKPPLSPRLNLPISPRTPQPGSPYKPRLQQQGYLSPTKATNNNSVE 233
PR+ SSPRPSPLSPRKPPLSPRLNLPISPRTPQPGSPY+PRLQQQGYLSPT A+ S+E
Sbjct: 175 PRIASSPRPSPLSPRKPPLSPRLNLPISPRTPQPGSPYRPRLQQQGYLSPTVAS---SLE 231
Query: 234 PSPCSSSTSSI-DSINELVANSKSAIADVEVKFSGPNLLLKTVSPRIPGQAVKIISALED 292
PSP +SS+SSI D+INELVANSKSAIADVEVKFSGPNLLLKTVSPRIPGQA KIISALE+
Sbjct: 232 PSPTTSSSSSINDNINELVANSKSAIADVEVKFSGPNLLLKTVSPRIPGQATKIISALEE 291
Query: 293 LAFEILHVNISTVDETMHNSFTIKV 317
L+ EILHVN+STVDETM NSFTIK+
Sbjct: 292 LSLEILHVNVSTVDETMLNSFTIKI 316
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224118162|ref|XP_002317746.1| predicted protein [Populus trichocarpa] gi|222858419|gb|EEE95966.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356518615|ref|XP_003527974.1| PREDICTED: transcription factor SPEECHLESS-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356509301|ref|XP_003523389.1| PREDICTED: transcription factor SPEECHLESS-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225462721|ref|XP_002267745.1| PREDICTED: transcription factor SPEECHLESS [Vitis vinifera] gi|302143687|emb|CBI22548.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357463825|ref|XP_003602194.1| Transcription factor SPEECHLESS [Medicago truncatula] gi|355491242|gb|AES72445.1| Transcription factor SPEECHLESS [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224116902|ref|XP_002331842.1| predicted protein [Populus trichocarpa] gi|222875080|gb|EEF12211.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449463493|ref|XP_004149468.1| PREDICTED: transcription factor SPEECHLESS-like [Cucumis sativus] gi|449531165|ref|XP_004172558.1| PREDICTED: transcription factor SPEECHLESS-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356546430|ref|XP_003541629.1| PREDICTED: transcription factor SPEECHLESS-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|312282859|dbj|BAJ34295.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 320 | ||||||
| TAIR|locus:2154197 | 364 | SPCH "AT5G53210" [Arabidopsis | 0.481 | 0.423 | 0.551 | 2.2e-69 | |
| UNIPROTKB|Q6ETQ5 | 415 | P0613F08.25 "Basic helix-loop- | 0.425 | 0.327 | 0.537 | 2.9e-50 | |
| UNIPROTKB|Q653A4 | 396 | OSJNBa0043B22.14 "Basic helix- | 0.278 | 0.224 | 0.706 | 6.8e-49 | |
| TAIR|locus:2093746 | 414 | FMA "AT3G24140" [Arabidopsis t | 0.315 | 0.243 | 0.537 | 1.5e-38 | |
| TAIR|locus:2082400 | 202 | MUTE "AT3G06120" [Arabidopsis | 0.196 | 0.311 | 0.746 | 6.4e-37 | |
| UNIPROTKB|Q5KQG3 | 227 | OSJNBb0086G17.12 "Putative unc | 0.196 | 0.277 | 0.730 | 2.4e-35 | |
| UNIPROTKB|Q8H7N8 | 329 | OJ1217B09.8 "BHLH transcriptio | 0.381 | 0.370 | 0.433 | 2e-30 | |
| UNIPROTKB|Q6ZGS3 | 373 | OJ1148_D05.9 "Putative basic-h | 0.893 | 0.766 | 0.300 | 3e-30 | |
| UNIPROTKB|Q7XLY9 | 362 | OSJNBa0086O06.20 "OSJNBa0086O0 | 0.293 | 0.259 | 0.525 | 6.8e-30 | |
| TAIR|locus:2009537 | 304 | AT1G22490 "AT1G22490" [Arabido | 0.268 | 0.282 | 0.544 | 1.8e-29 |
| TAIR|locus:2154197 SPCH "AT5G53210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 407 (148.3 bits), Expect = 2.2e-69, Sum P(3) = 2.2e-69
Identities = 85/154 (55%), Positives = 103/154 (66%)
Query: 18 ETNLAEDDLFAIFESLDSVTPLDEAATAVSEARLVSQKSTSSSILQESDETDQLTETLPK 77
+T+LA DDLFAI ESL+ + A + + S K E+ + + L
Sbjct: 16 DTSLAGDDLFAILESLEGAGEISPTAASTPKDGTTSSKELVKDQDYENSSPKRKKQRLET 75
Query: 78 NKRQKTAATSAVNSSDEANNTDGQQRMSHITVERNRRKQMNENLSVLRSLMPCFYVKRGD 137
K + ++E N DGQQ+MSH+TVERNRRKQMNE+L+VLRSLMPCFYVKRGD
Sbjct: 76 RKEEDEEEEDGDGEAEEDNKQDGQQKMSHVTVERNRRKQMNEHLTVLRSLMPCFYVKRGD 135
Query: 138 QASIIGGVVDYINELQQVLQSLEAKKQRKVYCEV 171
QASIIGGVV+YI+ELQQVLQSLEAKKQRK Y EV
Sbjct: 136 QASIIGGVVEYISELQQVLQSLEAKKQRKTYAEV 169
|
|
| UNIPROTKB|Q6ETQ5 P0613F08.25 "Basic helix-loop-helix-like" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q653A4 OSJNBa0043B22.14 "Basic helix-loop-helix-like" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093746 FMA "AT3G24140" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082400 MUTE "AT3G06120" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5KQG3 OSJNBb0086G17.12 "Putative uncharacterized protein OSJNBb0086G17.12" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8H7N8 OJ1217B09.8 "BHLH transcription factor" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZGS3 OJ1148_D05.9 "Putative basic-helix-loop-helix transcription factor" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7XLY9 OSJNBa0086O06.20 "OSJNBa0086O06.20 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009537 AT1G22490 "AT1G22490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 320 | |||
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 5e-13 | |
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 7e-13 | |
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 3e-09 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
Score = 62.6 bits (153), Expect = 5e-13
Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
Query: 99 DGQQRMSHITVERNRRKQMNENLSVLRSLMPCFYV-KRGDQASIIGGVVDYINELQQVLQ 157
+R +H ER RR+++N+ LRSL+P K+ +A I+ VDYI LQ++LQ
Sbjct: 1 RKSRREAHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELLQ 60
|
A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and have a PAS domain which allows the dimerization between PAS proteins, the binding of small molecules (e.g., dioxin), and interactions with non-PAS proteins. Length = 60 |
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 99.44 | |
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 99.42 | |
| smart00353 | 53 | HLH helix loop helix domain. | 99.37 | |
| KOG1318 | 411 | consensus Helix loop helix transcription factor EB | 99.19 | |
| KOG1319 | 229 | consensus bHLHZip transcription factor BIGMAX [Tra | 98.64 | |
| KOG2483 | 232 | consensus Upstream transcription factor 2/L-myc-2 | 98.38 | |
| KOG3561 | 803 | consensus Aryl-hydrocarbon receptor nuclear transl | 98.23 | |
| KOG4304 | 250 | consensus Transcriptional repressors of the hairy/ | 98.22 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 98.16 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 98.15 | |
| KOG3960 | 284 | consensus Myogenic helix-loop-helix transcription | 98.12 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 98.08 | |
| KOG4029 | 228 | consensus Transcription factor HAND2/Transcription | 97.99 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 97.97 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 97.95 | |
| KOG2588 | 953 | consensus Predicted DNA-binding protein [Transcrip | 97.92 | |
| KOG0561 | 373 | consensus bHLH transcription factor [Transcription | 97.86 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 97.69 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 97.48 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 97.35 | |
| KOG4447 | 173 | consensus Transcription factor TWIST [Transcriptio | 97.32 | |
| PLN03217 | 93 | transcription factor ATBS1; Provisional | 97.31 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 97.26 | |
| KOG3910 | 632 | consensus Helix loop helix transcription factor [T | 97.24 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 96.64 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 96.59 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 96.44 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 96.43 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 96.41 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 96.39 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 96.25 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 96.12 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 96.11 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 96.02 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 95.93 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 95.86 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 95.57 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 95.43 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 95.39 | |
| KOG3898 | 254 | consensus Transcription factor NeuroD and related | 95.38 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 95.21 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 95.14 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 95.1 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 95.05 | |
| PRK00194 | 90 | hypothetical protein; Validated | 94.99 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 94.97 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 94.85 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 94.82 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 94.81 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 94.72 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 94.6 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 94.25 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 94.19 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 94.05 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 93.97 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 93.78 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 93.75 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 93.49 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 93.26 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 92.74 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 92.61 | |
| KOG4395 | 285 | consensus Transcription factor Atonal, contains HT | 91.93 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 91.46 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 90.99 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 90.76 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 90.44 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 90.42 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 89.38 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 88.78 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 88.78 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 88.59 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 87.7 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 87.45 | |
| KOG4447 | 173 | consensus Transcription factor TWIST [Transcriptio | 86.26 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 86.23 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 83.98 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 83.94 | |
| KOG3560 | 712 | consensus Aryl-hydrocarbon receptor [Transcription | 83.93 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 83.81 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 83.72 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 83.47 | |
| KOG3558 | 768 | consensus Hypoxia-inducible factor 1/Neuronal PAS | 80.54 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 80.13 |
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
Probab=99.44 E-value=1.4e-13 Score=99.81 Aligned_cols=51 Identities=37% Similarity=0.612 Sum_probs=48.1
Q ss_pred ccchhHHHHHHHHHHHHHHHHHHhcCCCC---CCCCCChhhhHHHHHHHHHHHH
Q 042904 103 RMSHITVERNRRKQMNENLSVLRSLMPCF---YVKRGDQASIIGGVVDYINELQ 153 (320)
Q Consensus 103 r~~h~~~ER~RR~~in~~~~~LrslvP~~---~~~k~dKasIL~~AI~YIk~Lq 153 (320)
|..|+..||+||..||+.|..|+.+||.. ...|++|++||..||+||++||
T Consensus 2 R~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq 55 (55)
T PF00010_consen 2 RQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ 55 (55)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred CchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence 67899999999999999999999999996 4678999999999999999997
|
; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B .... |
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >KOG1318 consensus Helix loop helix transcription factor EB [Transcription] | Back alignment and domain information |
|---|
| >KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] | Back alignment and domain information |
|---|
| >KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] | Back alignment and domain information |
|---|
| >KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] | Back alignment and domain information |
|---|
| >KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG2588 consensus Predicted DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0561 consensus bHLH transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >KOG4447 consensus Transcription factor TWIST [Transcription] | Back alignment and domain information |
|---|
| >PLN03217 transcription factor ATBS1; Provisional | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG3910 consensus Helix loop helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >KOG4447 consensus Transcription factor TWIST [Transcription] | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 320 | |||
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 2e-11 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 4e-11 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 1e-10 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 1e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-09 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 9e-08 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 4e-07 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 5e-05 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 8e-05 |
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
Score = 58.1 bits (141), Expect = 2e-11
Identities = 15/75 (20%), Positives = 33/75 (44%)
Query: 91 SSDEANNTDGQQRMSHITVERNRRKQMNENLSVLRSLMPCFYVKRGDQASIIGGVVDYIN 150
+ D +D +R H +ER RR + ++ LR +P ++ +A I+ +YI
Sbjct: 1 NDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQ 60
Query: 151 ELQQVLQSLEAKKQR 165
+++ + +
Sbjct: 61 YMRRKNHTHQQDIDD 75
|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Length = 68 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 99.67 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 99.63 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 99.63 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.59 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 99.58 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 99.58 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 99.57 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 99.55 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 99.53 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 99.48 | |
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.42 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 99.35 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 99.32 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 98.94 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 98.81 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 98.75 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 98.66 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 98.42 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 96.25 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 95.34 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 93.32 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 91.21 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 87.51 |
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
Probab=99.67 E-value=6.5e-17 Score=126.14 Aligned_cols=66 Identities=21% Similarity=0.357 Sum_probs=61.2
Q ss_pred ccccchhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCChhhhHHHHHHHHHHHHHHHHHHHHHHHhhh
Q 042904 101 QQRMSHITVERNRRKQMNENLSVLRSLMPCFYVKRGDQASIIGGVVDYINELQQVLQSLEAKKQRKV 167 (320)
Q Consensus 101 ~~r~~h~~~ER~RR~~in~~~~~LrslvP~~~~~k~dKasIL~~AI~YIk~Lq~~v~~L~~~~~~~~ 167 (320)
.+|.+|+.+||+||++||++|..|++|||.. ..|+||++||.+||+||++||.+++.|+.+.+.+.
T Consensus 5 ~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~-~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~ 70 (82)
T 1am9_A 5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLR 70 (82)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHhhhhHHHHHHHHHHHHHHHHHHhccCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4588999999999999999999999999985 48999999999999999999999999999887654
|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 320 | ||||
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 2e-15 | |
| d1nkpa_ | 88 | a.38.1.1 (A:) Myc proto-oncogene protein {Human (H | 1e-14 | |
| d1mdya_ | 68 | a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul | 2e-14 | |
| d1am9a_ | 80 | a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI | 2e-13 | |
| d1nlwa_ | 79 | a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T | 5e-13 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 1e-12 | |
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 3e-12 | |
| d1uklc_ | 61 | a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId | 1e-09 |
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Max protein species: Human (Homo sapiens) [TaxId: 9606]
Score = 68.4 bits (167), Expect = 2e-15
Identities = 13/65 (20%), Positives = 29/65 (44%)
Query: 101 QQRMSHITVERNRRKQMNENLSVLRSLMPCFYVKRGDQASIIGGVVDYINELQQVLQSLE 160
+R H +ER RR + ++ LR +P ++ +A I+ +YI +++ + +
Sbjct: 1 DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQ 60
Query: 161 AKKQR 165
Sbjct: 61 QDIDD 65
|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 320 | |||
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 99.57 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 99.55 | |
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 99.54 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 99.49 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 96.32 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 96.31 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 92.88 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 92.66 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 92.14 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 91.26 |
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: SREBP-1a species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.61 E-value=3.3e-16 Score=119.51 Aligned_cols=66 Identities=21% Similarity=0.357 Sum_probs=60.7
Q ss_pred ccccchhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCChhhhHHHHHHHHHHHHHHHHHHHHHHHhhh
Q 042904 101 QQRMSHITVERNRRKQMNENLSVLRSLMPCFYVKRGDQASIIGGVVDYINELQQVLQSLEAKKQRKV 167 (320)
Q Consensus 101 ~~r~~h~~~ER~RR~~in~~~~~LrslvP~~~~~k~dKasIL~~AI~YIk~Lq~~v~~L~~~~~~~~ 167 (320)
.+|..|+.+||+||.+||+.|..|++|||.. ..|++|++||..||+||++|+++++.|..+...+.
T Consensus 5 ~kR~~H~~~Er~RR~~in~~~~~L~~llP~~-~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~lk 70 (80)
T d1am9a_ 5 EKRTAHNAIEKRYRSSINDKIIELKDLVVGT-EAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLR 70 (80)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHTCS-SCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHhcCCCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4578999999999999999999999999986 57999999999999999999999999998887643
|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|