Citrus Sinensis ID: 042938

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------

MDMVTRMVNEKPVVIFSKSECCICFSIQTLICGFGANPTVYELDQIPNGPQIERALQQLGCQPTVPAVFIGQRLVGGPNQVMSLHVQNELGPLLVRAGAIWLWKKK

cHHHHHHHHcccEEEEEcccccHHHHHHHHHHHcccccEEEEECcccccHHHHHHHHHHcccccccEEEEccEEEcccHHHHHHHHccccHHHHHHcccEEEEccc

MDMVTRMVNEKPVVIFSKSECCICFSIQTLICGFGANPTVYELDQIPNGPQIERALQQLGCQPTVPAVFIGQRLVGGPNQVMSLHVQNELGPLLVRAGAIWLWKKK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDMVTRMVNEKPVVIFSKSECCICFSIQTLICGFGANPTVYELDQIPNGPQIERALQQLGCQPTVPAVFIGQRLVGGPNQVMSLHVQNELGPLLVRAGAIWLWKKK

Annotation	Function Description	Confidence Level	Reference Protein
Monothiol glutaredoxin-S1	May only reduce GSH-thiol disulfides, but not protein disulfides.	probable	Q9SA68
Glutaredoxin-C1	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.	probable	Q7G8Y5
Glutaredoxin	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins (By similarity). Affects the culmination and cell fate decision by modulating the levels of reduced glutathione.	probable	Q54GP8

No EC number assigned to the protein, probably not an enzyme!

Template: 3L4N, chain A
Confidence level:very confident
Coverage over the Query: 2-105
View the alignment between query and template
View the model in PyMOL