Citrus Sinensis ID: 042966


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MREAKDGPPNRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSGLELGPKLNKVEELKEELERLRQRKEQEKALAHFRPSGTILASLSLPQFLEGDGIMR
cccccccccccccHHHccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHcccccccc
************LYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSGLEL****NKVEELKEE**********************ILASLSLPQFLEGDGIM*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MREAKDGPPNRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSGLExxxxxxxxxxxxxxxxxxxxxxxxxxxxAHFRPSGTILASLSLPQFLEGDGIMR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chaperone protein dnaJ 13 Have a continuous role in plant development probably in the structural organization of compartments (By similarity). Seems to be involved in resistance to oxidative stresses mediated by thiol-oxidizing agents such as diamide.probableQ39079

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EJ7, chain A
Confidence level:very confident
Coverage over the Query: 5-85
View the alignment between query and template
View the model in PyMOL
Template: 3LZ8, chain A
Confidence level:very confident
Coverage over the Query: 123-138
View the alignment between query and template
View the model in PyMOL