Citrus Sinensis ID: 042966

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MREAKDGPPNRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSGLELGPKLNKVEELKEELERLRQRKEQEKALAHFRPSGTILASLSLPQFLEGDGIMR
cccccccccccccHHHccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHcccccccc
ccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHcccccEEEEEEEccHHcccccccc
mreakdgppnrELYALlhlspeasdEEIRKAYRQWAQvyhpdkyqaphmkEIATENFQRICEAYEILSDENKRLIYDIYGmegltsglelgpklNKVEELKEELERLRQRKEQEKALahfrpsgtilaslslpqflegdgimr
mreakdgppnrelYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGltsglelgpkLNKVEELKEELERLRQRKEQEKAlahfrpsgtilaslslpqflegdgimr
MREAKDGPPNRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSGLELGPKLNKVeelkeelerlrqrkeqekALAHFRPSGTILASLSLPQFLEGDGIMR
*************YALLH*********IRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSGLEL*****************************************************
************LYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPH*KEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTS*L******NKVEELKEE**********************ILASLSLPQFLEGDGIM*
********PNRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSGLELGPKLNKVEELKEELERLRQRKEQEKALAHFRPSGTILASLSLPQFLEGDGIMR
**********RELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSGLELGPKLNKVEELKEELERLRQRKEQEKALAHFRPSGTILASLSLPQFLEGD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MREAKDGPPNRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSGLExxxxxxxxxxxxxxxxxxxxxxxxxxxxAHFRPSGTILASLSLPQFLEGDGIMR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query143 2.2.26 [Sep-21-2011]
Q39079 538 Chaperone protein dnaJ 13 yes no 0.979 0.260 0.778 2e-63
Q5RC70 559 DnaJ homolog subfamily C yes no 0.524 0.134 0.48 4e-14
Q9NVH1 559 DnaJ homolog subfamily C yes no 0.524 0.134 0.48 4e-14
Q5U458 559 DnaJ homolog subfamily C yes no 0.524 0.134 0.48 4e-14
Q54PV9 575 DnaJ homolog subfamily C yes no 0.839 0.208 0.325 5e-14
Q24133 334 DnaJ protein homolog 1 OS no no 0.489 0.209 0.513 7e-14
Q2NL21 559 DnaJ homolog subfamily C no no 0.524 0.134 0.48 9e-14
P25686 324 DnaJ homolog subfamily B no no 0.531 0.234 0.506 2e-13
Q9Y7T0 612 Uncharacterized J domain- yes no 0.832 0.194 0.352 2e-13
Q9QYI5 277 DnaJ homolog subfamily B no no 0.531 0.274 0.506 3e-13
>sp|Q39079|DNJ13_ARATH Chaperone protein dnaJ 13 OS=Arabidopsis thaliana GN=ATJ13 PE=1 SV=2 Back     alignment and function desciption
 Score =  240 bits (612), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 109/140 (77%), Positives = 127/140 (90%)

Query: 4   AKDGPPNRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEA 63
           A  GPPNRELYALL+LSPEASDEEIRKAYRQWAQVYHPDK Q+P MKE+ATENFQRICEA
Sbjct: 7   APTGPPNRELYALLNLSPEASDEEIRKAYRQWAQVYHPDKIQSPQMKEVATENFQRICEA 66

Query: 64  YEILSDENKRLIYDIYGMEGLTSGLELGPKLNKVEELKEELERLRQRKEQEKALAHFRPS 123
           YEILSDE KRLIYD+YGMEGL SGLELGP+L+K +E+KEELER+++R E+ K +AHF+P+
Sbjct: 67  YEILSDETKRLIYDLYGMEGLNSGLELGPRLSKADEIKEELERIKRRNEEAKKMAHFQPT 126

Query: 124 GTILASLSLPQFLEGDGIMR 143
           G+IL +LS+P FL GDGIMR
Sbjct: 127 GSILFNLSVPHFLVGDGIMR 146
Have a continuous role in plant development probably in the structural organization of compartments (By similarity). Seems to be involved in resistance to oxidative stresses mediated by thiol-oxidizing agents such as diamide.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5RC70|DJC11_PONAB DnaJ homolog subfamily C member 11 OS=Pongo abelii GN=DNAJC11 PE=2 SV=1 Back     alignment and function description
>sp|Q9NVH1|DJC11_HUMAN DnaJ homolog subfamily C member 11 OS=Homo sapiens GN=DNAJC11 PE=1 SV=2 Back     alignment and function description
>sp|Q5U458|DJC11_MOUSE DnaJ homolog subfamily C member 11 OS=Mus musculus GN=Dnajc11 PE=2 SV=2 Back     alignment and function description
>sp|Q54PV9|DJC11_DICDI DnaJ homolog subfamily C member 11 homolog OS=Dictyostelium discoideum GN=dnajc11 PE=3 SV=1 Back     alignment and function description
>sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 Back     alignment and function description
>sp|Q2NL21|DJC11_BOVIN DnaJ homolog subfamily C member 11 OS=Bos taurus GN=DNAJC11 PE=2 SV=1 Back     alignment and function description
>sp|P25686|DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens GN=DNAJB2 PE=1 SV=3 Back     alignment and function description
>sp|Q9Y7T0|YCJ3_SCHPO Uncharacterized J domain-containing protein C63.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC63.03 PE=3 SV=2 Back     alignment and function description
>sp|Q9QYI5|DNJB2_MOUSE DnaJ homolog subfamily B member 2 OS=Mus musculus GN=Dnajb2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
449504996 539 PREDICTED: chaperone protein dnaJ 13-lik 0.986 0.261 0.872 2e-69
224074151 539 predicted protein [Populus trichocarpa] 1.0 0.265 0.811 1e-63
118487705 310 unknown [Populus trichocarpa] 0.958 0.441 0.832 7e-63
224138588 540 predicted protein [Populus trichocarpa] 0.958 0.253 0.832 1e-62
225426989 537 PREDICTED: chaperone protein dnaJ 13 [Vi 0.993 0.264 0.809 1e-62
30686523 538 chaperone protein dnaJ 13 [Arabidopsis t 0.979 0.260 0.778 1e-61
4263783 537 putative DnaJ protein [Arabidopsis thali 0.979 0.260 0.778 2e-61
928936 539 J-domain protein [Arabidopsis thaliana] 0.979 0.259 0.778 2e-61
297823375 537 J-domain protein [Arabidopsis lyrata sub 0.958 0.255 0.795 2e-61
356497147 540 PREDICTED: chaperone protein dnaJ 13-lik 1.0 0.264 0.769 3e-60
>gi|449504996|ref|XP_004162349.1| PREDICTED: chaperone protein dnaJ 13-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 134/141 (95%)

Query: 3   EAKDGPPNRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICE 62
           E K GPPN++LYALLH+SPEASDEEIRKAYRQWAQVYHPDKYQ+PHMK+IATENFQRICE
Sbjct: 4   EEKAGPPNKDLYALLHISPEASDEEIRKAYRQWAQVYHPDKYQSPHMKDIATENFQRICE 63

Query: 63  AYEILSDENKRLIYDIYGMEGLTSGLELGPKLNKVEELKEELERLRQRKEQEKALAHFRP 122
           AYEIL+DENKR IYDIYGMEGLTSGLELGPKLNK +E+KEELERLR+RKEQEK  AHFRP
Sbjct: 64  AYEILTDENKRQIYDIYGMEGLTSGLELGPKLNKADEIKEELERLRKRKEQEKISAHFRP 123

Query: 123 SGTILASLSLPQFLEGDGIMR 143
           SGTILA++SLP FLEGDGIMR
Sbjct: 124 SGTILANMSLPHFLEGDGIMR 144

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224074151|ref|XP_002304275.1| predicted protein [Populus trichocarpa] gi|222841707|gb|EEE79254.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118487705|gb|ABK95677.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224138588|ref|XP_002326640.1| predicted protein [Populus trichocarpa] gi|222833962|gb|EEE72439.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225426989|ref|XP_002270066.1| PREDICTED: chaperone protein dnaJ 13 [Vitis vinifera] gi|297741195|emb|CBI31926.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|30686523|ref|NP_181115.2| chaperone protein dnaJ 13 [Arabidopsis thaliana] gi|67462402|sp|Q39079.2|DNJ13_ARATH RecName: Full=Chaperone protein dnaJ 13; Short=AtDjB13; Short=AtJ13 gi|330254056|gb|AEC09150.1| chaperone protein dnaJ 13 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4263783|gb|AAD15443.1| putative DnaJ protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|928936|emb|CAA89204.1| J-domain protein [Arabidopsis thaliana] gi|1585434|prf||2124427A diamide resistance gene Back     alignment and taxonomy information
>gi|297823375|ref|XP_002879570.1| J-domain protein [Arabidopsis lyrata subsp. lyrata] gi|297325409|gb|EFH55829.1| J-domain protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356497147|ref|XP_003517424.1| PREDICTED: chaperone protein dnaJ 13-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
TAIR|locus:2058704 538 OWL1 "AT2G35720" [Arabidopsis 0.979 0.260 0.707 1.5e-49
RGD|1307453 382 Dnajb5 "DnaJ (Hsp40) homolog, 0.573 0.214 0.438 1.5e-15
MGI|MGI:1930018 348 Dnajb5 "DnaJ (Hsp40) homolog, 0.510 0.209 0.467 1.8e-15
UNIPROTKB|J3KNR7 382 DNAJB5 "DnaJ homolog subfamily 0.573 0.214 0.438 2.4e-15
UNIPROTKB|F1NUM7 561 DNAJC11 "Uncharacterized prote 0.538 0.137 0.493 2.5e-15
UNIPROTKB|Q5BIP8 348 DNAJB5 "DnaJ homolog subfamily 0.510 0.209 0.467 3.1e-15
UNIPROTKB|O75953 348 DNAJB5 "DnaJ homolog subfamily 0.510 0.209 0.467 3.1e-15
UNIPROTKB|F1SII0 420 DNAJB5 "Uncharacterized protei 0.573 0.195 0.438 4e-15
UNIPROTKB|Q58DD3 278 DNAJB2 "DnaJ (Hsp40) homolog, 0.531 0.273 0.506 4.2e-15
FB|FBgn0263106 334 DnaJ-1 "DnaJ-like-1" [Drosophi 0.538 0.230 0.5 4.3e-15
TAIR|locus:2058704 OWL1 "AT2G35720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 516 (186.7 bits), Expect = 1.5e-49, P = 1.5e-49
 Identities = 99/140 (70%), Positives = 111/140 (79%)

Query:     4 AKDGPPNRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEA 63
             A  GPPNRELYALL+LSPEASDEEIRKAYRQWAQVYHPDK Q+P MKE+ATENFQRICEA
Sbjct:     7 APTGPPNRELYALLNLSPEASDEEIRKAYRQWAQVYHPDKIQSPQMKEVATENFQRICEA 66

Query:    64 YEILSDENKRLIYDIYGMEGLTSGLELGPKLNKVXXXXXXXXXXXXXXXXXXALAHFRPS 123
             YEILSDE KRLIYD+YGMEGL SGLELGP+L+K                    +AHF+P+
Sbjct:    67 YEILSDETKRLIYDLYGMEGLNSGLELGPRLSKADEIKEELERIKRRNEEAKKMAHFQPT 126

Query:   124 GTILASLSLPQFLEGDGIMR 143
             G+IL +LS+P FL GDGIMR
Sbjct:   127 GSILFNLSVPHFLVGDGIMR 146
GO:0006457 "protein folding" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009644 "response to high light intensity" evidence=IMP
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=IMP
GO:0055122 "response to very low light intensity stimulus" evidence=IMP
GO:0009536 "plastid" evidence=IDA
RGD|1307453 Dnajb5 "DnaJ (Hsp40) homolog, subfamily B, member 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1930018 Dnajb5 "DnaJ (Hsp40) homolog, subfamily B, member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNR7 DNAJB5 "DnaJ homolog subfamily B member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUM7 DNAJC11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5BIP8 DNAJB5 "DnaJ homolog subfamily B member 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O75953 DNAJB5 "DnaJ homolog subfamily B member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SII0 DNAJB5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DD3 DNAJB2 "DnaJ (Hsp40) homolog, subfamily B, member 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0263106 DnaJ-1 "DnaJ-like-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q39079DNJ13_ARATHNo assigned EC number0.77850.97900.2602yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00030501
hypothetical protein (539 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 4e-23
pfam0022663 pfam00226, DnaJ, DnaJ domain 6e-23
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 5e-20
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 1e-19
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-18
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 3e-18
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 3e-18
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 5e-18
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-17
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 4e-17
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 4e-17
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 1e-16
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-16
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 2e-16
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 8e-16
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 8e-16
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 9e-16
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 9e-15
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 9e-15
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-14
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 1e-14
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 1e-13
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 1e-13
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 1e-13
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-13
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-13
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 5e-13
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 2e-12
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-12
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 3e-12
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 3e-11
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 1e-10
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 1e-10
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 1e-10
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 3e-10
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 1e-09
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 2e-09
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 2e-07
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 4e-05
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 6e-05
PTZ00100116 PTZ00100, PTZ00100, DnaJ chaperone protein; Provis 0.002
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 92.3 bits (230), Expect = 4e-23
 Identities = 35/75 (46%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 10 NRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSD 69
           R+ Y +L +S +AS+EEI+KAYR+ A+ YHPD+       + A E F+ I EAYE+LSD
Sbjct: 3  KRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNP---GDKEAEEKFKEINEAYEVLSD 59

Query: 70 ENKRLIYDIYGMEGL 84
            KR  YD +G  G 
Sbjct: 60 PEKRAAYDQFGHAGF 74

Length = 371
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|240265 PTZ00100, PTZ00100, DnaJ chaperone protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 143
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.94
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.92
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.89
PRK14288 369 chaperone protein DnaJ; Provisional 99.88
PRK14296 372 chaperone protein DnaJ; Provisional 99.87
PRK14286 372 chaperone protein DnaJ; Provisional 99.86
PRK14287 371 chaperone protein DnaJ; Provisional 99.86
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.86
PRK14276 380 chaperone protein DnaJ; Provisional 99.86
PRK14279 392 chaperone protein DnaJ; Provisional 99.85
PRK14280 376 chaperone protein DnaJ; Provisional 99.85
PRK14298 377 chaperone protein DnaJ; Provisional 99.85
PRK14299 291 chaperone protein DnaJ; Provisional 99.85
PRK14294 366 chaperone protein DnaJ; Provisional 99.84
PRK14285 365 chaperone protein DnaJ; Provisional 99.84
PRK14291 382 chaperone protein DnaJ; Provisional 99.84
PRK14282 369 chaperone protein DnaJ; Provisional 99.84
PRK14297 380 chaperone protein DnaJ; Provisional 99.84
PRK14278 378 chaperone protein DnaJ; Provisional 99.84
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.84
PRK14283 378 chaperone protein DnaJ; Provisional 99.84
PRK14301 373 chaperone protein DnaJ; Provisional 99.83
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.83
PRK14277 386 chaperone protein DnaJ; Provisional 99.83
PRK14281 397 chaperone protein DnaJ; Provisional 99.82
PRK14295 389 chaperone protein DnaJ; Provisional 99.82
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.82
PRK14290 365 chaperone protein DnaJ; Provisional 99.81
PRK14284 391 chaperone protein DnaJ; Provisional 99.81
PRK10767 371 chaperone protein DnaJ; Provisional 99.81
PRK14293 374 chaperone protein DnaJ; Provisional 99.81
PRK14292 371 chaperone protein DnaJ; Provisional 99.81
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
PRK14289 386 chaperone protein DnaJ; Provisional 99.8
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.8
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.79
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PRK14300 372 chaperone protein DnaJ; Provisional 99.79
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.76
PRK01356166 hscB co-chaperone HscB; Provisional 99.74
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.73
PRK05014171 hscB co-chaperone HscB; Provisional 99.72
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.71
PRK00294173 hscB co-chaperone HscB; Provisional 99.7
PRK03578176 hscB co-chaperone HscB; Provisional 99.7
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
PHA03102153 Small T antigen; Reviewed 99.7
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.68
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.63
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.56
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.55
PRK01773173 hscB co-chaperone HscB; Provisional 99.54
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.49
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.47
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.45
PTZ00100116 DnaJ chaperone protein; Provisional 99.44
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.38
PHA02624 647 large T antigen; Provisional 99.37
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.36
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.22
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.22
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.85
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 98.48
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.47
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.46
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.45
KOG0431453 consensus Auxilin-like protein and related protein 97.17
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.94
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 95.4
PF1344662 RPT: A repeated domain in UCH-protein 90.93
PF14687112 DUF4460: Domain of unknown function (DUF4460) 89.98
KOG0724 335 consensus Zuotin and related molecular chaperones 84.13
COG555288 Uncharacterized conserved protein [Function unknow 83.14
PF1004178 DUF2277: Uncharacterized conserved protein (DUF227 83.04
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=9.2e-33  Score=226.69  Aligned_cols=134  Identities=43%  Similarity=0.719  Sum_probs=130.6

Q ss_pred             CCccccccccccccCCCCHHHHHHHHHHHHHHhCCCCCCCchhHHHHHHHHHHHHHHHHHhcchhHHHHHhhhcCCccc-
Q 042966            7 GPPNRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLT-   85 (143)
Q Consensus         7 ~~~~~~~Y~vLgl~~~as~~~Ik~ayr~l~~~~HPDk~~~~~~~~~a~~~f~~i~~Ay~~L~dp~~R~~YD~~~~~~~~-   85 (143)
                      .+++.+||.+|+||++||.++|++|||++|+.|||||+.+|..+..|++.|+.|++||+||+||.+|++||.+|++|+. 
T Consensus         5 e~~e~e~Ya~LNlpkdAt~eeI~~AYrr~~~lfHPDkh~dpd~K~~AE~~F~~i~~AyEVLsDp~kRaIYD~~G~qGL~t   84 (546)
T KOG0718|consen    5 ELDEIELYALLNLPKDATDEEIKKAYRRLSRLFHPDKHTDPDQKKAAEEKFQRIQRAYEVLSDPQKRAIYDNYGEQGLKT   84 (546)
T ss_pred             ccchhhHHHHhCCCcccCHHHHHHHHHHHHHhcCCcccCChhHHHHHHHHHHHHHHHHHHhcChHHHHHHHHhhhccccc
Confidence            6678899999999999999999999999999999999999999999999999999999999999999999999999999 


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhhcCCcccEEEeechhhhcCCCC
Q 042966           86 SGLELGPKLNKVEELKEELERLRQRKEQEKALAHFRPSGTILASLSLPQFLEGDG  140 (143)
Q Consensus        86 ~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~  140 (143)
                      .||+.+....+++|++++++++.+++++.+++++++++|++.+++++..+|..+|
T Consensus        85 ~gwEl~~r~~tpeEIreE~Erl~r~~de~~l~qr~~P~g~i~i~v~~t~lF~~~d  139 (546)
T KOG0718|consen   85 EGWELGFRGKTPEEIREEYERLQRERDERRLQQRVQPTGEITINVNATPLFARND  139 (546)
T ss_pred             cCceeecCCCCHHHHHHHHHHHHHHHHHHHHHhhcCCCceEEEEecchhhhccCc
Confidence            9999999999999999999999999999999999999999999999999999887

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5552 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10041 DUF2277: Uncharacterized conserved protein (DUF2277); InterPro: IPR018735 Members of this family of hypothetical bacterial proteins have no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 3e-14
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 2e-13
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 2e-12
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 8e-12
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 3e-11
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 2e-10
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 2e-10
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-10
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 4e-10
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 5e-10
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 6e-10
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 8e-10
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 1e-09
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-09
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 3e-09
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 3e-08
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 7e-08
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 7e-07
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 5e-06
2qsa_A109 Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 5e-05
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 1e-04
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 1e-04
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 3e-04
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 9e-04
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure 
Iteration: 1

 Score = 73.9 bits (180), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 53/79 (67%), Gaps = 3/79 (3%)
Query: 14 YALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKR 73
          Y +L +   AS ++I+KAYR+ A  +HPDK   P  KE A + F+ + EAYE+LSD++KR
Sbjct: 5  YEILDVPRSASADDIKKAYRRKALQWHPDK--NPDNKEFAEKKFKEVAEAYEVLSDKHKR 62
Query: 74 LIYDIYGMEGLTSGLELGP 92
           IYD YG EGLT G   GP
Sbjct: 63 EIYDRYGREGLT-GTGTGP 80
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 1e-24
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-23
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 3e-23
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 1e-22
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 2e-22
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 3e-22
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 4e-22
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 2e-21
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 2e-21
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 1e-20
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 1e-20
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 1e-20
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 3e-20
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-20
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 1e-19
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-19
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 4e-19
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-18
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-18
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-18
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 2e-18
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 3e-18
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-17
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 4e-17
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-15
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 3e-15
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 5e-14
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 2e-13
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 2e-11
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 4e-11
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 5e-11
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 4e-10
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 8e-09
2guz_A71 Mitochondrial import inner membrane translocase su 1e-08
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
 Score = 90.1 bits (224), Expect = 1e-24
 Identities = 37/77 (48%), Positives = 50/77 (64%), Gaps = 2/77 (2%)

Query: 11 RELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDE 70
             Y +L +   AS ++I+KAYR+ A  +HPDK   P  KE A + F+ + EAYE+LSD+
Sbjct: 2  ASYYEILDVPRSASADDIKKAYRRKALQWHPDK--NPDNKEFAEKKFKEVAEAYEVLSDK 59

Query: 71 NKRLIYDIYGMEGLTSG 87
          +KR IYD YG EGLT  
Sbjct: 60 HKREIYDRYGREGLTGT 76
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.91
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.91
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.9
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.9
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.89
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.89
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.89
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.89
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.88
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.88
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.87
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.87
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.87
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.87
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.87
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.86
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.84
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.83
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.82
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.82
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.82
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.82
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.8
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.79
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.79
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.78
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.77
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.77
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.76
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.72
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.72
2guz_A71 Mitochondrial import inner membrane translocase su 99.71
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.69
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.32
2guz_B65 Mitochondrial import inner membrane translocase su 99.03
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 91.41
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
Probab=99.91  E-value=2.8e-24  Score=138.93  Aligned_cols=74  Identities=51%  Similarity=0.840  Sum_probs=68.2

Q ss_pred             cccccccccccCCCCHHHHHHHHHHHHHHhCCCCCCCchhHHHHHHHHHHHHHHHHHhcchhHHHHHhhhcCCcccCC
Q 042966           10 NRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLTSG   87 (143)
Q Consensus        10 ~~~~Y~vLgl~~~as~~~Ik~ayr~l~~~~HPDk~~~~~~~~~a~~~f~~i~~Ay~~L~dp~~R~~YD~~~~~~~~~~   87 (143)
                      ..|||+||||++++|.++||++|+++++.+|||+++++.    +.+.|+.|++||++|+||.+|..||.+|..+...+
T Consensus         2 ~~~~y~iLgv~~~as~~~Ik~ayr~l~~~~HPD~~~~~~----~~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~~~~~   75 (77)
T 1hdj_A            2 GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPG----AEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGS   75 (77)
T ss_dssp             CCCSHHHHTCCTTCCHHHHHHHHHHHHHTTCTTTCCCTT----HHHHHHHHHHHHHHTTCHHHHHHHHHTCGGGCCSS
T ss_pred             CCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCcc----HHHHHHHHHHHHHHHCCHHHHHHHHHHcccccccC
Confidence            368999999999999999999999999999999998654    78899999999999999999999999998877643
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 143
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 7e-18
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 5e-17
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 6e-17
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 7e-17
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 8e-14
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 9e-13
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 3e-11
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 7e-11
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 71.5 bits (175), Expect = 7e-18
 Identities = 13/69 (18%), Positives = 32/69 (46%)

Query: 8  PPNRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEIL 67
                +  + ++   + E+++K YR+   V HPDK      ++ A   F  + +A+   
Sbjct: 30 WAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEF 89

Query: 68 SDENKRLIY 76
           ++ ++ +Y
Sbjct: 90 ENQGQKPLY 98
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.93
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.88
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.84
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.82
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.82
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.75
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.93  E-value=4.6e-26  Score=145.50  Aligned_cols=73  Identities=42%  Similarity=0.734  Sum_probs=66.4

Q ss_pred             cccccccccccCCCCHHHHHHHHHHHHHHhCCCCCCCchhHHHHHHHHHHHHHHHHHhcchhHHHHHhhhcCCccc
Q 042966           10 NRELYALLHLSPEASDEEIRKAYRQWAQVYHPDKYQAPHMKEIATENFQRICEAYEILSDENKRLIYDIYGMEGLT   85 (143)
Q Consensus        10 ~~~~Y~vLgl~~~as~~~Ik~ayr~l~~~~HPDk~~~~~~~~~a~~~f~~i~~Ay~~L~dp~~R~~YD~~~~~~~~   85 (143)
                      .+|||+||||++++|.++||+||+++++.+|||+++++.   .+...|..|++||+||+||.+|..||.+|..+..
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~---~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~e   74 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDK---EAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE   74 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTC---HHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSCC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCCh---HHHHHHHHHHHHHHhcCCHHHHHHHHHhCccccC
Confidence            479999999999999999999999999999999987542   3678899999999999999999999999877653
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure