Citrus Sinensis ID: 042996

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MDLSSISDDLAEINGQITDIFRALSNGFQKLEKIKDVNRQSRQLEELTDKMRECKRLIKEFDREVKDIEGRNDPETNKMLSEKKQSMVKELNSYVALKKQHQTNLENNKRVDLFDGPNEGFAEDNVLLASSMTNQQLMDSGNRMMDETDQAIERSKQVVHETINVGTETAAVLKAQTEQMSRIVNELDSIHFSIKKASQLVKEIGRQVATDKCIMAMLFLIVIGVIAIIIVKLVNPNNKDIRDIPGLAPPAMARRLLSNPR
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHEEEccccccccccccccccHHHHHcccccc
******SDDLAEINGQITDIFRALSNGFQKL************************RLIKE**************************************************************************************************VHETINVGTETAAVLKAQTEQMSRIVNELDSIHFSIKKASQLVKEIGRQVATDKCIMAMLFLIVIGVIAIIIVKLVNPNNKDI**************LLS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLSSISDDLAEINGQITDIFRALSNGFQKLEKIKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNDPETNKMLSEKKQSMVKELNSYVALKKQHQTNLENNKRVDLFDGPNEGFAEDNVLLASSMTNQQLMDSGNRMMDETDQAIERSKQVVHETINVGTETAAVLKAQTEQMSRIVNELDSIHFSIKKASQLVKEIGRQVATDKCIMAMLFLIVIGVIAIIIVKLVNPNNKDIRDIPGLAPPAMARRLLSNPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Novel plant SNARE 11 t-SNARE involved in diverse vesicle trafficking and membrane fusion processes, including cell plate formation.confidentQ944A9
Novel plant SNARE 13 Vesicle trafficking protein that functions in the secretory pathway.probableQ9LRP1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NPS, chain C
Confidence level:confident
Coverage over the Query: 133-210
View the alignment between query and template
View the model in PyMOL
Template: 1VCS, chain A
Confidence level:confident
Coverage over the Query: 5-103
View the alignment between query and template
View the model in PyMOL