Citrus Sinensis ID: 043000


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630----
MAVMFQPWLLLLYILISVIPFSSCQPRNIETFYPFDPSSSPAPSPTITSDPPIITPLPPPRSPQLVPPPPSLSAPQSGSPSDNKTIAKAVAATAASTLFIAVLFFFALQRYVLRKRQRVGDGDHNNSNEGRPSNEFTRFDGNLRGLIVDENGLDVLYWRKLEEGDKRKGFDREILHSPRHEEEKEQGMSINKFEAVQEVPLLRGKSSSSHVKVQPENDDLDHIITSKPTTTPAPSALKTIQEKQPPIQQSNVPPPPPPIQNNKSTAAPPPPPPPPPQPVSAKKNPAPPPPPTSILKPPSVPKRSSNEGQLKDSSAETGNGNGHVKLKPLHWDKVNKNVEHSMVWDKIDGGSFRFDGDLMEALFGYVATNRRSPTRERNSKNSTGPNSQVILLDARKSQNTAIVLKSLALSRGELLSAILDGKELNPETLEKLTRVAPTKEEQSKILDFDGDPTRLADAESFHYHILKAVPSAYTRLNALLFRSNYDSEIAQFKETLQTLELGCKELRTRGLLLKLLEAILKAGNRMNAGTARGNAQAFNLTALRKLSDVKSTDGKTTLLHFVVEEVVRAEGRRCVINRNRSLSRSGSSRNSSSGSLTSENSTPKEEKEKEYMRLGLPVIGGLSAEFSNVKKAAT
cccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccHHHHHHHHcccccccccccccccccccccccccEEEEccHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHcccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHcc
**VMFQPWLLLLYILISVIPFSSCQPRNIETFYP****************************************************AKAVAATAASTLFIAVLFFFALQRYVLRK*********************TRFDGNLRGLIVDENGLDVLYWRKLE*******************************************************************************************************************************************************************LKPLHWDKVNKNVEHSMVWDKIDGGSFRFDGDLMEALFGYVAT*********************ILLDARKSQNTAIVLKSLALSRGELLSAILDGKELNPETLEKLTRVAPTKEEQSKILDFDGD*TRLADAESFHYHILKAVPSAYTRLNALLFRSNYDSEIAQFKETLQTLELGCKELRTRGLLLKLLEAILKAGNRMNAGTARGNAQAFNLTALRKLSDVKSTDGKTTLLHFVVEEVVRAEGRRCVINRNR*********************************LGLPVIGGLSAEFSNVKKA**
xxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVMFQPWLLLLYILISVIPFSSCQPRNIETFYPFDPSSSPAPSPTITSDPPIITPLPPPRSPQLVPPPPSLSAPQSGSPSDNKTIAKAVAATAASTLFIAVLFFFALQRYVLRKRQRVGDGDHNNSNEGRPSNEFTRFDGNLRGLIVDENGLDVLYWRKLEEGDKRKGFDREILHSPRHEEEKEQGMSINKFEAVQEVPLLRGKSSSSHVKVQPENDDLDHIITSKPTTTPAPSALKTIQEKQPPIQQSNVPPPPPPIQNNKSTAAPPPPPPPPPQPVSAKKNPAPPPPPTSILKPPSVPKRSSNEGQLKDSSAETGNGNGHVKLKPLHWDKVNKNVEHSMVWDKIDGGSFRFDGDLMEALFGYVATNRRSPTRERNSKNSTGPNSQVILLDARKSQNTAIVLKSLALSRGELLSAILDGKELNPETLEKLTRVAPTKEEQSKILDFDGDPTRLADAESFHYHILKAVPSAYTRLNALLFRSNYDSExxxxxxxxxxxxxxxxxxxxxGLLLKLLEAILKAGNRMNAGTARGNAQAFNLTALRKLSDVKSTDGKTTLLHFVVEEVVRAEGRRCVINRNRSLSRSGSSRNSSSGSLTSENSTPKEEKEKEYMRLGLPVIGGLSAEFSNVKKAAT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Formin-like protein 8 Might be involved in the organization and polarity of the actin cytoskeleton. Interacts with the barbed end of actin filaments and nucleates actin-filament polymerization in vitro.probableO04532

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J1D, chain G
Confidence level:very confident
Coverage over the Query: 317-367,387-585
View the alignment between query and template
View the model in PyMOL
Template: 1V9D, chain A
Confidence level:very confident
Coverage over the Query: 422-513,531-576,598-633
View the alignment between query and template
View the model in PyMOL
Template: 2GRX, chain C
Confidence level:probable
Coverage over the Query: 304-317
View the alignment between query and template
View the model in PyMOL