Citrus Sinensis ID: 043022


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-
MAAVSAAVSLPTSKSTSLPTRTSIISPDRITFRKVPFYYKDVSTGGRVVSVRAQVTTEAPAKVEKESKKMEEGVIVNKFKPKTPYIGRCLLNTKITGDDAPGETWHMVFSTEGEVPYKEGQSIGVIADGVDKNAKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNENGEIVKGVCSNFLCDLKPGAEVKITGPVGKEMLMPRDPNATVIMLATGTGIAPFRGFLWKMFFEKHEDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQKNEKGEKMYIQTRMAEYANELWELLKKDNTYVYMCGLRGMEKGIDDIMVSLAANDGIDWLDYKKQLKKSEQWNVEVY
cccEEEEEECcccccccccccccccccccccccccccEEccccccccccEEEccccccccccccccccccccccccccccccccEEEEEEEEEECcccccccccEEEEEccccccccccccccccccHHHHcccccccccccccccccccccccccEEEEEEEEEEEEcccccccccccHHHHcccccccEEEEEEcccccccccccccccEEEEEccccHHHHHHHHHHHHHHccccccccccEEEEEccccccccccHHHHHHHHHHcccccEEEEEEEcccccccccEEEHHHHHHHcHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccEEccc
****SAA*******************PDRITFRKVPFYYKDVSTGGRVVSVRAQ******************GVIVNKFKPKTPYIGRCLLNTKITGDDAPGETWHMVFSTEGEVPYKEGQSIGVIADGVDKNAKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNENGEIVKGVCSNFLCDLKPGAEVKITGPVGKEMLMPRDPNATVIMLATGTGIAPFRGFLWKMFFEKHEDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQKNEKGEKMYIQTRMAEYANELWELLKKDNTYVYMCGLRGMEKGIDDIMVSLAANDGIDWLDYKKQLKKSEQWNVEVY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAVSAAVSLPTSKSTSLPTRTSIISPDRITFRKVPFYYKDVSTGGRVVSVRAQVTTEAPAKVEKESKKMEEGVIVNKFKPKTPYIGRCLLNTKITGDDAPGETWHMVFSTEGEVPYKEGQSIGVIADGVDKNAKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNENGEIVKGVCSNFLCDLKPGAEVKITGPVGKEMLMPRDPNATVIMLATGTGIAPFRGFLWKMFFEKHEDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQKNEKGEKMYIQTRMAEYANELWELLKKDNTYVYMCGLRGMEKGIDDIMVSLAANDGIDWLDYKKQLKKSEQWNVEVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ferredoxin--NADP reductase, leaf isozyme 2, chloroplastic Plays a key role in regulating the relative amounts of cyclic and non-cyclic electron flow to meet the demands of the plant for ATP and reducing power.confidentQ8W493
Ferredoxin--NADP reductase, leaf isozyme, chloroplastic May play a key role in regulating the relative amounts of cyclic and non-cyclic electron flow to meet the demands of the plant for ATP and reducing power.confidentP41344
Ferredoxin--NADP reductase, chloroplastic May play a key role in regulating the relative amounts of cyclic and non-cyclic electron flow to meet the demands of the plant for ATP and reducing power.probableP00455

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.18.-.-Acting on iron-sulfur proteins as donors.probable
1.18.1.-With NAD(+) or NADP(+) as acceptor.probable
1.18.1.2Transferred entry: 1.18.1.2.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FNB, chain A
Confidence level:very confident
Coverage over the Query: 66-361
View the alignment between query and template
View the model in PyMOL
Template: 4DQL, chain A
Confidence level:very confident
Coverage over the Query: 27-95,111-361
View the alignment between query and template
View the model in PyMOL