Citrus Sinensis ID: 043043


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MEIIEKAGSVPVVNGPKKKHFMAVVGSVLACSVLICILEIVLSFVLIWRKQKPDEFPLAMDWSLLHVHEGGGSHGGFPEGTGFPVHNVNLGLKIPYVEIKFATHNFDRKLVMGKGAFGNVYRGTLRNSMKVAVKRGETGSGQGLPEFQTAIIVL
ccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEEEccccEEEEEEccccccccHHHHHHHHHcc
ccEEccccccccccccccccHHHEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEcHHHHHHHHccccHccEEcccccccEEEEEcccccEEEEEEccccccccHHHHHHHEEEc
meiiekagsvpvvngpkkKHFMAVVGSVLACSVLICILEIVLSFVLIWrkqkpdefplamdwsllhvhegggshggfpegtgfpvhnvnlglkipyVEIKFAthnfdrklvmgkgafgnvyrgtlrNSMKVAVKrgetgsgqglpefqTAIIVL
meiiekagsvpvvngpkKKHFMAVVGSVLACSVLICILEIVLSFVLIWRKQKPDEFPLAMDWSLLHVHEGGGSHGGFPEGTGFPVHNVNLGLKIPYVEIKFATHNFDRKLVMGKGAFGnvyrgtlrnSMKVAVKRgetgsgqglpefqtaiivl
MEIIEKAGSVPVVNGPKKKHFMAVVGSVLACSVLICILEIVLSFVLIWRKQKPDEFPLAMDWSLLHVHEgggshggfpegtgFPVHNVNLGLKIPYVEIKFATHNFDRKLVMGKGAFGNVYRGTLRNSMKVAVKRGETGSGQGLPEFQTAIIVL
****************KKKHFMAVVGSVLACSVLICILEIVLSFVLIWRKQKPDEFPLAMDWSLLHVHEGGGSHGGFPEGTGFPVHNVNLGLKIPYVEIKFATHNFDRKLVMGKGAFGNVYRGTLRNSMKVA**********************
*************************GSVLACSVLICILEIVLSFVLI********************************************LKIPYVEIKFATHNFDRKLVMGKGAFGNVYRGTLRNSMKVAV*R************QTAIIVL
MEIIEKAGSVPVVNGPKKKHFMAVVGSVLACSVLICILEIVLSFVLIWRKQKPDEFPLAMDWSLLHVHEGGGSHGGFPEGTGFPVHNVNLGLKIPYVEIKFATHNFDRKLVMGKGAFGNVYRGTLRNSMKVAVKRGETGSGQGLPEFQTAIIVL
********SV********KHFMAVVGSVLACSVLICILEIVLSFVLIWRKQK************************************NLGLKIPYVEIKFATHNFDRKLVMGKGAFGNVYRGTLRNSMKVAVKRGETGSGQGLPEFQTAIIVL
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIIEKAGSVPVVNGPKKKHFMAVVGSVLACSVLICILEIVLSFVLIWRKQKPDEFPLAMDWSLLHVHEGGGSHGGFPEGTGFPVHNVNLGLKIPYVEIKFATHNFDRKLVMGKGAFGNVYRGTLRNSMKVAVKRGETGSGQGLPEFQTAIIVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
O22187 834 Probable receptor-like pr yes no 1.0 0.184 0.367 6e-20
Q9FLW0 824 Probable receptor-like pr no no 0.915 0.171 0.363 3e-15
Q9LX66 830 Receptor-like protein kin no no 0.818 0.151 0.363 8e-13
O80623 815 Probable receptor-like pr no no 0.571 0.107 0.433 9e-12
Q9FLJ8 842 Probable receptor-like pr no no 0.909 0.166 0.312 2e-11
Q9T020 878 Probable receptor-like pr no no 0.714 0.125 0.389 2e-11
Q9SA72 849 Probable receptor-like pr no no 0.922 0.167 0.315 4e-11
Q9SCZ4 895 Receptor-like protein kin no no 0.766 0.131 0.351 4e-10
Q9LK35 855 Receptor-like protein kin no no 0.785 0.141 0.284 4e-10
Q9FN92 829 Probable receptor-like pr no no 0.428 0.079 0.484 6e-10
>sp|O22187|Y2232_ARATH Probable receptor-like protein kinase At2g23200 OS=Arabidopsis thaliana GN=At2g23200 PE=3 SV=1 Back     alignment and function desciption
 Score = 96.3 bits (238), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 57/155 (36%), Positives = 84/155 (54%), Gaps = 1/155 (0%)

Query: 1   MEIIEKAGSVPVVNGPKKKHFMAVVGSVLACSVLICILEIVLSFVLIWRKQKPDEFPLAM 60
           ME++ K+GS        + H +       A +  +    + + F+   R +K        
Sbjct: 382 MEVLSKSGSDYSNRSSSRVHIITGCAVAAAAASALVFSLLFMVFLKRRRSKKTKPEVEGT 441

Query: 61  DWSLLHVHEGGGSHG-GFPEGTGFPVHNVNLGLKIPYVEIKFATHNFDRKLVMGKGAFGN 119
            WS L +H GG S      +    P+ N++LGL IP+ +I  AT+NFD +L++GKG FG 
Sbjct: 442 VWSPLPLHRGGSSDNRPISQYHNSPLRNLHLGLTIPFTDILSATNNFDEQLLIGKGGFGY 501

Query: 120 VYRGTLRNSMKVAVKRGETGSGQGLPEFQTAIIVL 154
           VY+  L +  K A+KRG+TGSGQG+ EFQT I VL
Sbjct: 502 VYKAILPDGTKAAIKRGKTGSGQGILEFQTEIQVL 536





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q9FLW0|Y5241_ARATH Probable receptor-like protein kinase At5g24010 OS=Arabidopsis thaliana GN=At5g24010 PE=1 SV=1 Back     alignment and function description
>sp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 1 OS=Arabidopsis thaliana GN=HERK1 PE=1 SV=1 Back     alignment and function description
>sp|O80623|Y2393_ARATH Probable receptor-like protein kinase At2g39360 OS=Arabidopsis thaliana GN=At2g39360 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLJ8|Y5613_ARATH Probable receptor-like protein kinase At5g61350 OS=Arabidopsis thaliana GN=At5g61350 PE=2 SV=1 Back     alignment and function description
>sp|Q9T020|Y4391_ARATH Probable receptor-like protein kinase At4g39110 OS=Arabidopsis thaliana GN=At4g39110 PE=1 SV=1 Back     alignment and function description
>sp|Q9SA72|Y1357_ARATH Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=1 SV=1 Back     alignment and function description
>sp|Q9SCZ4|FERON_ARATH Receptor-like protein kinase FERONIA OS=Arabidopsis thaliana GN=FER PE=1 SV=1 Back     alignment and function description
>sp|Q9LK35|THE1_ARATH Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana GN=THE1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g59700 OS=Arabidopsis thaliana GN=At5g59700 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
225438853 842 PREDICTED: probable receptor-like protei 0.980 0.179 0.506 5e-29
147801769 842 hypothetical protein VITISV_030033 [Viti 0.980 0.179 0.5 6e-29
296087389 839 unnamed protein product [Vitis vinifera] 0.980 0.179 0.519 2e-28
147834523 839 hypothetical protein VITISV_000519 [Viti 0.980 0.179 0.519 2e-28
359480653 826 PREDICTED: probable receptor-like protei 0.980 0.182 0.519 2e-28
356514284 816 PREDICTED: probable receptor-like protei 0.928 0.175 0.460 3e-28
255567913 807 Nodulation receptor kinase precursor, pu 0.980 0.187 0.474 4e-27
359497624 497 PREDICTED: receptor-like protein kinase 0.980 0.303 0.512 2e-26
351724465 691 protein kinase family protein [Glycine m 0.980 0.218 0.459 5e-26
225438863 835 PREDICTED: probable receptor-like protei 0.935 0.172 0.475 1e-25
>gi|225438853|ref|XP_002278695.1| PREDICTED: probable receptor-like protein kinase At5g24010 [Vitis vinifera] gi|296087388|emb|CBI33762.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 79/156 (50%), Positives = 101/156 (64%), Gaps = 5/156 (3%)

Query: 1   MEIIEKAGSVPVVNGPKKKHFMAVVGSVLACSVLICILEIVLSFVLIWRKQKPDEFPLAM 60
           MEI+++ G V + N  KKK+   +VGSV+    L+C++ +VL      RK KP +   A 
Sbjct: 397 MEIMQELGWVSIENESKKKYIPLLVGSVVGGLALVCLVVVVLLLQSKCRKGKPTQ---AT 453

Query: 61  DWSLLHVHEGGGSHGGFPEGTGF--PVHNVNLGLKIPYVEIKFATHNFDRKLVMGKGAFG 118
           DW  + V  G  SHG   E T    PV  +NLGLKIP+ E++ AT NF  KL++GKG FG
Sbjct: 454 DWLPITVDRGLSSHGRLHEATNHSSPVPYLNLGLKIPFAEVRSATKNFSSKLLVGKGGFG 513

Query: 119 NVYRGTLRNSMKVAVKRGETGSGQGLPEFQTAIIVL 154
            VY+GTLRN MKVAVKR + G GQGLPEFQT I+VL
Sbjct: 514 KVYQGTLRNGMKVAVKRSQPGHGQGLPEFQTEILVL 549




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147801769|emb|CAN74534.1| hypothetical protein VITISV_030033 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087389|emb|CBI33763.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147834523|emb|CAN60912.1| hypothetical protein VITISV_000519 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480653|ref|XP_003632509.1| PREDICTED: probable receptor-like protein kinase At2g23200-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356514284|ref|XP_003525836.1| PREDICTED: probable receptor-like protein kinase At2g23200-like [Glycine max] Back     alignment and taxonomy information
>gi|255567913|ref|XP_002524934.1| Nodulation receptor kinase precursor, putative [Ricinus communis] gi|223535769|gb|EEF37431.1| Nodulation receptor kinase precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359497624|ref|XP_003635588.1| PREDICTED: receptor-like protein kinase THESEUS 1-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|351724465|ref|NP_001235011.1| protein kinase family protein [Glycine max] gi|223452391|gb|ACM89523.1| protein kinase family protein [Glycine max] Back     alignment and taxonomy information
>gi|225438863|ref|XP_002278764.1| PREDICTED: probable receptor-like protein kinase At2g23200-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
TAIR|locus:2058636 834 AT2G23200 [Arabidopsis thalian 0.987 0.182 0.356 1.4e-18
TAIR|locus:2178707 824 AT5G24010 [Arabidopsis thalian 0.961 0.179 0.350 1.3e-14
TAIR|locus:2075346 830 HERK1 "hercules receptor kinas 0.915 0.169 0.317 1.1e-12
TAIR|locus:2151349 855 THE1 "THESEUS1" [Arabidopsis t 0.935 0.168 0.314 1e-11
TAIR|locus:2123056 656 CRK32 "cysteine-rich RLK (RECE 0.409 0.096 0.412 1.8e-11
UNIPROTKB|Q40234 321 Pto "Pto disease resistance pr 0.402 0.193 0.483 3.3e-11
TAIR|locus:2204564 849 HERK2 "hercules receptor kinas 0.922 0.167 0.308 3.5e-11
TAIR|locus:2039717 815 AT2G39360 [Arabidopsis thalian 0.811 0.153 0.323 1.5e-10
TAIR|locus:2174249 829 AT5G59700 [Arabidopsis thalian 0.818 0.151 0.312 2.5e-10
TAIR|locus:2123126 666 CRK31 "cysteine-rich RLK (RECE 0.409 0.094 0.412 2.5e-10
TAIR|locus:2058636 AT2G23200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 235 (87.8 bits), Expect = 1.4e-18, P = 1.4e-18
 Identities = 56/157 (35%), Positives = 84/157 (53%)

Query:     1 MEIIEKAGSVPVVNGPKKKHFMAVVGSVLACSVLICILEIVLSFVLIWRKQKPDEFPLAM 60
             ME++ K+GS        + H   + G  +A +    ++  +L  V + R++     P   
Sbjct:   382 MEVLSKSGSDYSNRSSSRVHI--ITGCAVAAAAASALVFSLLFMVFLKRRRSKKTKPEVE 439

Query:    61 D--WSLLHVHEXXXXXXX-XXXXXXFPVHNVNLGLKIPYVEIKFATHNFDRKLVMGKGAF 117
                WS L +H                P+ N++LGL IP+ +I  AT+NFD +L++GKG F
Sbjct:   440 GTVWSPLPLHRGGSSDNRPISQYHNSPLRNLHLGLTIPFTDILSATNNFDEQLLIGKGGF 499

Query:   118 GNVYRGTLRNSMKVAVKRGETGSGQGLPEFQTAIIVL 154
             G VY+  L +  K A+KRG+TGSGQG+ EFQT I VL
Sbjct:   500 GYVYKAILPDGTKAAIKRGKTGSGQGILEFQTEIQVL 536




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0051510 "regulation of unidimensional cell growth" evidence=RCA
TAIR|locus:2178707 AT5G24010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075346 HERK1 "hercules receptor kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151349 THE1 "THESEUS1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123056 CRK32 "cysteine-rich RLK (RECEPTOR-like protein kinase) 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40234 Pto "Pto disease resistance protein" [Solanum pimpinellifolium (taxid:4084)] Back     alignment and assigned GO terms
TAIR|locus:2204564 HERK2 "hercules receptor kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039717 AT2G39360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174249 AT5G59700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123126 CRK31 "cysteine-rich RLK (RECEPTOR-like protein kinase) 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00019576001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (856 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-04
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-04
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 0.001
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 0.001
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 0.002
cd05085 250 cd05085, PTKc_Fer, Catalytic domain of the Protein 0.004
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
 Score = 40.2 bits (95), Expect = 1e-04
 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 7/34 (20%)

Query: 106 FDRKLVMGKGAFGNVYRGTLR-----NSMKVAVK 134
             +KL  G+GAFG VY+GTL+        KVAVK
Sbjct: 3   LGKKL--GEGAFGEVYKGTLKGDGEGTETKVAVK 34


Length = 258

>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
KOG1187 361 consensus Serine/threonine protein kinase [Signal 99.34
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 98.99
KOG3653 534 consensus Transforming growth factor beta/activin 98.8
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.6
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 98.59
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 98.54
KOG2052 513 consensus Activin A type IB receptor, serine/threo 98.48
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 98.26
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 97.86
PLN03224 507 probable serine/threonine protein kinase; Provisio 97.69
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 97.66
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 97.5
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 97.43
KOG0192 362 consensus Tyrosine kinase specific for activated ( 97.42
KOG0595 429 consensus Serine/threonine-protein kinase involved 97.32
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 97.31
PRK09188 365 serine/threonine protein kinase; Provisional 97.31
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 97.24
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 97.15
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 97.14
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 97.11
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 97.04
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 97.04
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 97.0
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 97.0
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 96.95
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 96.93
PHA02988 283 hypothetical protein; Provisional 96.91
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 96.91
KOG0580 281 consensus Serine/threonine protein kinase [Cell cy 96.9
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 96.9
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 96.9
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 96.89
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 96.87
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 96.86
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 96.85
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 96.84
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 96.84
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 96.84
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 96.82
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 96.81
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 96.76
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 96.76
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 96.74
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 96.74
PTZ00284 467 protein kinase; Provisional 96.74
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 96.71
PF12877 684 DUF3827: Domain of unknown function (DUF3827); Int 96.7
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 96.7
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 96.69
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 96.67
PLN00034 353 mitogen-activated protein kinase kinase; Provision 96.65
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 96.65
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 96.62
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 96.6
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 96.59
KOG0201 467 consensus Serine/threonine protein kinase [Signal 96.59
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 96.58
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 96.57
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 96.53
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 96.51
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 96.5
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 96.49
PTZ00283 496 serine/threonine protein kinase; Provisional 96.48
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 96.47
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 96.45
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 96.42
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 96.4
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 96.4
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 96.39
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 96.39
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 96.38
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 96.38
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 96.36
KOG0575 592 consensus Polo-like serine/threonine protein kinas 96.34
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 96.33
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 96.32
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 96.29
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 96.28
PTZ00263 329 protein kinase A catalytic subunit; Provisional 96.25
PTZ00036 440 glycogen synthase kinase; Provisional 96.25
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 96.22
KOG0198 313 consensus MEKK and related serine/threonine protei 96.22
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 96.22
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 96.21
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 96.2
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 96.2
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 96.2
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 96.16
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 96.11
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 96.11
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 96.1
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 96.1
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 96.09
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 96.07
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 96.05
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 96.04
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 96.04
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 96.02
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 96.02
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 96.02
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 96.0
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 96.0
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 96.0
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 95.97
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 95.96
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 95.96
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 95.95
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 95.95
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 95.95
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 95.94
PF08374221 Protocadherin: Protocadherin; InterPro: IPR013585 95.94
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 95.92
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 95.92
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 95.91
cd05144 198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 95.9
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 95.9
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 95.88
PLN00009 294 cyclin-dependent kinase A; Provisional 95.88
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 95.87
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 95.87
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 95.86
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 95.84
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 95.84
KOG1989 738 consensus ARK protein kinase family [Signal transd 95.84
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 95.83
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 95.81
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 95.81
PF15102146 TMEM154: TMEM154 protein family 95.8
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 95.8
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 95.8
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 95.79
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 95.79
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 95.78
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 95.77
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 95.75
KOG0581 364 consensus Mitogen-activated protein kinase kinase 95.75
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 95.74
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 95.72
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 95.72
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 95.71
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 95.71
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 95.7
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 95.69
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 95.65
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 95.65
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 95.65
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 95.62
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 95.61
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 95.6
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 95.59
KOG0605 550 consensus NDR and related serine/threonine kinases 95.58
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 95.52
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 95.52
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 95.52
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 95.49
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 95.47
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 95.44
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 95.41
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 95.39
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 95.38
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 95.37
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 95.36
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 95.36
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 95.35
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 95.35
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 95.33
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 95.33
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 95.32
PF06365202 CD34_antigen: CD34/Podocalyxin family; InterPro: I 95.28
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 95.28
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 95.27
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 95.27
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 95.25
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 95.24
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 95.24
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 95.21
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 95.2
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 95.18
KOG0694 694 consensus Serine/threonine protein kinase [Signal 95.16
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 95.13
KOG0577 948 consensus Serine/threonine protein kinase [Signal 95.12
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 95.08
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 95.07
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 95.05
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 95.04
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 95.01
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 94.98
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 94.97
PF1457575 EphA2_TM: Ephrin type-A receptor 2 transmembrane d 94.96
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 94.95
PTZ00024 335 cyclin-dependent protein kinase; Provisional 94.89
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 94.83
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 94.81
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 94.78
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 94.77
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 94.77
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 94.76
smart00090 237 RIO RIO-like kinase. 94.62
PF15345233 TMEM51: Transmembrane protein 51 94.59
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 94.58
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 94.51
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 94.47
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 94.47
PF05454290 DAG1: Dystroglycan (Dystrophin-associated glycopro 94.47
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 94.45
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 94.44
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 94.39
KOG0582 516 consensus Ste20-like serine/threonine protein kina 94.38
PF02009299 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR00 94.34
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 94.34
PRK09605 535 bifunctional UGMP family protein/serine/threonine 94.3
PHA03212 391 serine/threonine kinase US3; Provisional 94.19
PF06697278 DUF1191: Protein of unknown function (DUF1191); In 94.15
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 93.94
PHA02882 294 putative serine/threonine kinase; Provisional 93.94
KOG0607 463 consensus MAP kinase-interacting kinase and relate 93.75
PF02480439 Herpes_gE: Alphaherpesvirus glycoprotein E; InterP 93.65
PTZ00266 1021 NIMA-related protein kinase; Provisional 93.52
PF0539394 Hum_adeno_E3A: Human adenovirus early E3A glycopro 93.37
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 93.32
KOG0598 357 consensus Ribosomal protein S6 kinase and related 93.26
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 93.13
PHA03211 461 serine/threonine kinase US3; Provisional 93.11
PF13908179 Shisa: Wnt and FGF inhibitory regulator 92.95
KOG1167 418 consensus Serine/threonine protein kinase of the C 92.76
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 92.43
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 92.35
PTZ00046358 rifin; Provisional 92.3
PF03302397 VSP: Giardia variant-specific surface protein; Int 92.12
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 92.01
PTZ00267 478 NIMA-related protein kinase; Provisional 91.99
TIGR01477353 RIFIN variant surface antigen, rifin family. This 91.96
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 91.95
KOG0661 538 consensus MAPK related serine/threonine protein ki 91.94
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 91.52
TIGR01478295 STEVOR variant surface antigen, stevor family. Thi 91.48
PHA03207 392 serine/threonine kinase US3; Provisional 91.42
PF15069143 FAM163: FAM163 family 91.36
KOG0583 370 consensus Serine/threonine protein kinase [Signal 91.23
KOG0578 550 consensus p21-activated serine/threonine protein k 91.21
PTZ00370296 STEVOR; Provisional 91.13
PF0468969 S1FA: DNA binding protein S1FA; InterPro: IPR00677 91.07
PRK10359 232 lipopolysaccharide core biosynthesis protein; Prov 91.04
PF01299306 Lamp: Lysosome-associated membrane glycoprotein (L 91.02
PF03229126 Alpha_GJ: Alphavirus glycoprotein J; InterPro: IPR 90.93
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 90.9
PHA03265402 envelope glycoprotein D; Provisional 90.85
PHA03209 357 serine/threonine kinase US3; Provisional 90.76
PF15050133 SCIMP: SCIMP protein 90.72
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 90.53
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 90.37
PF15176102 LRR19-TM: Leucine-rich repeat family 19 TM domain 90.28
KOG0586 596 consensus Serine/threonine protein kinase [General 90.24
PF12191129 stn_TNFRSF12A: Tumour necrosis factor receptor stn 90.13
PF0720498 Orthoreo_P10: Orthoreovirus membrane fusion protei 90.05
KOG1027 903 consensus Serine/threonine protein kinase and endo 89.97
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 89.47
PTZ00208436 65 kDa invariant surface glycoprotein; Provisional 89.24
COG0661 517 AarF Predicted unusual protein kinase [General fun 89.11
KOG0611 668 consensus Predicted serine/threonine protein kinas 88.84
PF10873155 DUF2668: Protein of unknown function (DUF2668); In 88.79
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 88.37
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 88.26
PF0721379 DAP10: DAP10 membrane protein; InterPro: IPR009861 87.92
KOG0596 677 consensus Dual specificity; serine/threonine and t 87.79
PF05568189 ASFV_J13L: African swine fever virus J13L protein; 87.72
KOG0984 282 consensus Mitogen-activated protein kinase (MAPK) 87.66
PHA03265402 envelope glycoprotein D; Provisional 87.64
PF14610189 DUF4448: Protein of unknown function (DUF4448) 87.15
PF12768281 Rax2: Cortical protein marker for cell polarity 86.89
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 86.75
PHA03210 501 serine/threonine kinase US3; Provisional 86.19
KOG0610 459 consensus Putative serine/threonine protein kinase 86.07
COG2112 201 Predicted Ser/Thr protein kinase [Signal transduct 85.67
KOG42581025 consensus Insulin/growth factor receptor (contains 85.58
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 85.28
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 85.23
PF10577 807 UPF0560: Uncharacterised protein family UPF0560; I 85.17
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 84.84
KOG4721 904 consensus Serine/threonine protein kinase, contain 84.67
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 84.19
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 84.08
PF02480439 Herpes_gE: Alphaherpesvirus glycoprotein E; InterP 83.89
PHA03099139 epidermal growth factor-like protein (EGF-like pro 83.44
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 82.03
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 81.76
PF14914154 LRRC37AB_C: LRRC37A/B like protein 1 C-terminal do 81.63
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 81.52
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 80.08
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.34  E-value=2.5e-12  Score=97.70  Aligned_cols=65  Identities=40%  Similarity=0.628  Sum_probs=56.5

Q ss_pred             CcccccHHHHHHhhcCccccceeecCCCcceEEEEeCCCCEEEEEEecCCCCCChHHHHHHHhhC
Q 043043           90 LGLKIPYVEIKFATHNFDRKLVMGKGAFGNVYRGTLRNSMKVAVKRGETGSGQGLPEFQTAIIVL  154 (154)
Q Consensus        90 ~~~~~~~~~l~~at~~f~~~~~iG~g~~g~vy~g~l~~g~~vaVK~l~~~~~~~~~~f~~e~~~l  154 (154)
                      ..+.|++.+|..||++|+..++||+|+||.||+|.+++|..||||++.....+...+|.+|+++|
T Consensus        61 ~~~~fs~~el~~AT~~Fs~~~~ig~Ggfg~VYkG~l~~~~~vAVK~~~~~~~~~~~eF~~Ei~~l  125 (361)
T KOG1187|consen   61 PLRSFSYDELRKATNNFSESNLIGEGGFGTVYKGVLSDGTVVAVKRLSSNSGQGEREFLNEVEIL  125 (361)
T ss_pred             CcceeeHHHHHHHHhCCchhcceecCCCeEEEEEEECCCCEEEEEEecCCCCcchhHHHHHHHHH
Confidence            45679999999999999999999999999999999999999999999755433146699999864



>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>PF12877 DUF3827: Domain of unknown function (DUF3827); InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ] Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>PF06365 CD34_antigen: CD34/Podocalyxin family; InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>PF14575 EphA2_TM: Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PF15345 TMEM51: Transmembrane protein 51 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>PF05454 DAG1: Dystroglycan (Dystrophin-associated glycoprotein 1); InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF02009 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PF06697 DUF1191: Protein of unknown function (DUF1191); InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF02480 Herpes_gE: Alphaherpesvirus glycoprotein E; InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PF05393 Hum_adeno_E3A: Human adenovirus early E3A glycoprotein; InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PF13908 Shisa: Wnt and FGF inhibitory regulator Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00046 rifin; Provisional Back     alignment and domain information
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>TIGR01477 RIFIN variant surface antigen, rifin family Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information
>TIGR01478 STEVOR variant surface antigen, stevor family Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PF15069 FAM163: FAM163 family Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00370 STEVOR; Provisional Back     alignment and domain information
>PF04689 S1FA: DNA binding protein S1FA; InterPro: IPR006779 S1FA is an unusual small plant peptide of only 70 amino acids with a basic domain which contains a nuclear localization signal and a putative DNA binding helix Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PF01299 Lamp: Lysosome-associated membrane glycoprotein (Lamp); InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear Back     alignment and domain information
>PF03229 Alpha_GJ: Alphavirus glycoprotein J; InterPro: IPR004913 The exact function of the herpesvirus glycoprotein J is unknown, but it appears to play a role in the inhibition of apotosis of the host cell [] Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>PHA03265 envelope glycoprotein D; Provisional Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PF15050 SCIMP: SCIMP protein Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF15176 LRR19-TM: Leucine-rich repeat family 19 TM domain Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PF12191 stn_TNFRSF12A: Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain; InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins Back     alignment and domain information
>PF07204 Orthoreo_P10: Orthoreovirus membrane fusion protein p10; InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00208 65 kDa invariant surface glycoprotein; Provisional Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PF10873 DUF2668: Protein of unknown function (DUF2668); InterPro: IPR022640 Members in this family of proteins are annotated as cysteine and tyrosine-rich protein 1, however currently no function is known [] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF07213 DAP10: DAP10 membrane protein; InterPro: IPR009861 This family consists of several mammalian DAP10 membrane proteins Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05568 ASFV_J13L: African swine fever virus J13L protein; InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>PHA03265 envelope glycoprotein D; Provisional Back     alignment and domain information
>PF14610 DUF4448: Protein of unknown function (DUF4448) Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4258 consensus Insulin/growth factor receptor (contains protein kinase domain) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PF10577 UPF0560: Uncharacterised protein family UPF0560; InterPro: IPR018890 This family of proteins has no known function Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02480 Herpes_gE: Alphaherpesvirus glycoprotein E; InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PF14914 LRRC37AB_C: LRRC37A/B like protein 1 C-terminal domain Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 3e-09
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 4e-09
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 2e-05
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 2e-05
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure

Iteration: 1

Score = 57.4 bits (137), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 25/51 (49%), Positives = 36/51 (70%) Query: 93 KIPYVEIKFATHNFDRKLVMGKGAFGNVYRGTLRNSMKVAVKRGETGSGQG 143 ++P V+++ AT+NFD K ++G G FG VY+G LR+ KVA+KR S QG Sbjct: 28 RVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQG 78
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 2e-22
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 2e-14
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 6e-12
3soc_A 322 Activin receptor type-2A; structural genomics cons 6e-07
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 1e-05
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-05
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 1e-05
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-05
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-05
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 3e-05
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 4e-05
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 7e-05
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-04
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 1e-04
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-04
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-04
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-04
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-04
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-04
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-04
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-04
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 4e-04
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 4e-04
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 4e-04
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 5e-04
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 5e-04
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 5e-04
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 6e-04
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 6e-04
3pls_A 298 Macrophage-stimulating protein receptor; protein k 7e-04
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 7e-04
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 8e-04
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 8e-04
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 8e-04
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 8e-04
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 8e-04
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 9e-04
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 9e-04
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
 Score = 90.0 bits (224), Expect = 2e-22
 Identities = 30/64 (46%), Positives = 43/64 (67%)

Query: 91  GLKIPYVEIKFATHNFDRKLVMGKGAFGNVYRGTLRNSMKVAVKRGETGSGQGLPEFQTA 150
             ++P V+++ AT+NFD K ++G G FG VY+G LR+  KVA+KR    S QG+ EF+T 
Sbjct: 26  SYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETE 85

Query: 151 IIVL 154
           I  L
Sbjct: 86  IETL 89


>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 98.52
4aoj_A 329 High affinity nerve growth factor receptor; transf 98.44
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 98.41
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 98.25
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 98.24
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 98.15
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 98.14
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 98.01
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 97.98
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 97.93
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 97.91
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 97.81
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 97.75
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 97.68
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 97.68
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 97.64
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 97.64
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 97.6
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 97.54
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 97.54
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 97.53
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 97.53
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 97.52
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 97.52
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 97.49
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 97.49
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 97.47
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 97.46
3niz_A 311 Rhodanese family protein; structural genomics, str 97.45
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 97.44
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 97.43
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 97.42
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 97.4
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 97.39
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 97.39
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 97.38
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 97.37
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 97.33
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 97.33
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 97.33
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 97.32
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 97.32
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 97.32
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 97.32
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 97.31
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 97.3
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 97.3
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 97.3
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 97.3
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 97.29
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 97.25
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 97.25
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 97.24
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 97.23
1zar_A 282 RIO2 kinase; serine kinase, winged-helix, RIO doma 97.23
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 97.22
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 97.22
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 97.22
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 97.21
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 97.21
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 97.21
3o0g_A 292 Cell division protein kinase 5; kinase activator c 97.2
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 97.19
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 97.19
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 97.18
3uqc_A 286 Probable conserved transmembrane protein; structur 97.16
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 97.15
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 97.15
3q4u_A 301 Activin receptor type-1; structural genomics conso 97.14
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 97.13
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 97.12
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 97.12
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 97.09
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 97.08
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 97.08
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 97.07
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 97.07
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 97.07
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 97.06
3ork_A 311 Serine/threonine protein kinase; structural genomi 97.04
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 97.03
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 97.02
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 97.02
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 97.02
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 97.01
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 97.01
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 97.01
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 97.01
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 97.01
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 97.0
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 97.0
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 97.0
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 96.99
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 96.99
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 96.98
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 96.97
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 96.97
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 96.95
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 96.94
3soc_A 322 Activin receptor type-2A; structural genomics cons 96.94
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 96.93
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 96.92
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 96.92
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 96.91
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 96.9
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 96.89
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 96.89
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 96.89
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 96.88
3rp9_A 458 Mitogen-activated protein kinase; structural genom 96.88
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 96.86
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 96.86
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 96.86
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 96.86
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 96.84
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 96.84
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 96.84
3bhy_A 283 Death-associated protein kinase 3; death associate 96.84
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 96.83
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 96.83
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 96.83
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 96.82
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 96.82
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 96.82
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 96.82
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 96.81
2a19_B 284 Interferon-induced, double-stranded RNA-activated 96.81
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 96.81
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 96.8
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 96.79
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 96.78
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 96.78
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 96.77
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 96.77
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 96.76
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 96.76
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 96.75
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 96.74
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 96.74
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 96.73
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 96.73
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 96.72
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 96.72
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 96.71
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 96.71
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 96.71
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 96.71
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 96.71
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 96.7
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 96.7
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 96.7
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 96.7
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 96.68
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 96.68
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 96.67
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 96.67
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 96.66
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 96.66
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 96.66
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 96.66
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 96.65
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 96.64
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 96.63
1zth_A 258 RIO1 serine protein kinase; ribosome biogenesis, r 96.63
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 96.63
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 96.62
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 96.61
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 96.61
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 96.61
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 96.61
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 96.6
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 96.6
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 96.6
3pls_A 298 Macrophage-stimulating protein receptor; protein k 96.59
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 96.58
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 96.58
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 96.57
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 96.57
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 96.57
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 96.56
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 96.56
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 96.56
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 96.56
3an0_A 340 Dual specificity mitogen-activated protein kinase; 96.55
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 96.55
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 96.55
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 96.54
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 96.53
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 96.53
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 96.53
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 96.52
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 96.52
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 96.52
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 96.51
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 96.51
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 96.51
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 96.5
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 96.49
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 96.48
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 96.48
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 96.47
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 96.45
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 96.45
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 96.45
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 96.45
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 96.44
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 96.44
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 96.43
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 96.43
3aln_A 327 Dual specificity mitogen-activated protein kinase; 96.42
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 96.42
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 96.42
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 96.41
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 96.41
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 96.39
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 96.38
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 96.38
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 96.37
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 96.37
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 96.36
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 96.36
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 96.35
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 96.35
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 96.34
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 96.33
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 96.33
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 96.31
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 96.29
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 96.27
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 96.25
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 96.24
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 96.24
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 96.23
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 96.23
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 96.22
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 96.2
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 96.19
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 96.14
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 96.14
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 96.1
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 96.06
3fme_A 290 Dual specificity mitogen-activated protein kinase; 96.01
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 96.0
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 95.92
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 95.91
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 95.91
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 95.91
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 95.89
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 95.81
2dyl_A 318 Dual specificity mitogen-activated protein kinase 95.8
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 95.71
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 95.5
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 95.47
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 95.37
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 95.34
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 95.29
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 95.22
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 94.23
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 94.02
1iij_A35 ERBB-2 receptor protein-tyrosine kinase; alpha-hel 93.06
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 91.46
2l8s_A54 Integrin alpha-1; transmembrane region, detergent 90.22
2klu_A70 T-cell surface glycoprotein CD4; cell membrane, di 88.73
2knc_A54 Integrin alpha-IIB; transmembrane signaling, prote 88.17
1q55_A880 EP-cadherin, C-cadherin; trans interaction, desmos 83.86
2l34_A33 TYRO protein tyrosine kinase-binding protein; immu 81.49
2k1a_A42 Integrin alpha-IIB; single-PASS transmembrane segm 80.12
2llm_A43 Amyloid beta A4 protein; alzheimer'S disease, prot 81.17
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
Probab=98.52  E-value=3e-08  Score=73.02  Aligned_cols=46  Identities=28%  Similarity=0.439  Sum_probs=34.6

Q ss_pred             cceeecCCCcceEEEEeC------CCCEEEEEEecCC-CCCChHHHHHHHhhC
Q 043043          109 KLVMGKGAFGNVYRGTLR------NSMKVAVKRGETG-SGQGLPEFQTAIIVL  154 (154)
Q Consensus       109 ~~~iG~g~~g~vy~g~l~------~g~~vaVK~l~~~-~~~~~~~f~~e~~~l  154 (154)
                      .+.||+|+||.||+|.+.      ++..||||++... .....++|.+|+.+|
T Consensus        31 ~~~lG~G~fG~Vykg~~~~~~~~~~~~~VAvK~l~~~~~~~~~~~f~~E~~il   83 (308)
T 4gt4_A           31 MEELGEDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLR   83 (308)
T ss_dssp             EEEEEECSSCEEEEEEEC-------CEEEEEEECCC-CCC-CHHHHHHHHHHH
T ss_pred             eeEeccCCCcEEEEEEEcCCccCCCCeEEEEEEECcccChHHHHHHHHHHHHH
Confidence            356999999999999983      4578999999643 333457899999764



>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1iij_A ERBB-2 receptor protein-tyrosine kinase; alpha-helix-PI-bulge-alpha-helix, signaling protein; NMR {Synthetic} SCOP: j.35.1.1 Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>2l8s_A Integrin alpha-1; transmembrane region, detergent micelle, CE adhesion; NMR {Homo sapiens} Back     alignment and structure
>2klu_A T-cell surface glycoprotein CD4; cell membrane, disulfide bond, HOST- virus interaction, immune response, immunoglobulin domain, lipoprotein; NMR {Homo sapiens} Back     alignment and structure
>2knc_A Integrin alpha-IIB; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>2l34_A TYRO protein tyrosine kinase-binding protein; immunoreceptor, transmembrane assembly, DAP12, protein bindi; NMR {Homo sapiens} PDB: 2l35_B Back     alignment and structure
>2k1a_A Integrin alpha-IIB; single-PASS transmembrane segment, alternative splicing, calcium, cell adhesion, cleavage on PAIR of basic residues; NMR {Homo sapiens} PDB: 2k9j_A Back     alignment and structure
>2llm_A Amyloid beta A4 protein; alzheimer'S disease, protein fibril; NMR {Homo sapiens} PDB: 2loh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-06
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-06
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 4e-06
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 5e-06
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-05
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-05
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-05
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-05
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 6e-05
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 8e-05
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-04
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-04
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-04
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 4e-04
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 5e-04
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 5e-04
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-04
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 6e-04
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 6e-04
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 6e-04
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 7e-04
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 7e-04
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 7e-04
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 9e-04
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 0.001
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 0.001
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 0.001
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 0.001
d1zara2 191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 0.002
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 0.002
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 0.003
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 0.003
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 0.003
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 0.003
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 0.004
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 0.004
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 0.004
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 0.004
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 0.004
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 0.004
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 0.004
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-src tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.7 bits (105), Expect = 1e-06
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 98  EIKFATHNFDRKLVMGKGAFGNVYRGTLRNSMKVAVKR 135
           EI   +   + KL  G+G FG V+ GT   + +VA+K 
Sbjct: 13  EIPRESLRLEVKL--GQGCFGEVWMGTWNGTTRVAIKT 48


>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 98.49
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 98.43
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 98.41
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 98.4
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 98.34
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 98.25
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 98.21
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 98.2
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 98.18
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 98.08
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.03
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 98.01
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 98.01
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 98.0
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 98.0
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 97.98
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 97.95
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 97.95
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 97.94
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 97.94
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 97.92
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 97.91
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 97.89
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 97.88
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 97.85
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 97.85
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 97.8
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 97.78
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 97.77
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 97.76
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 97.75
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 97.74
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 97.73
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 97.72
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 97.69
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 97.66
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 97.65
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 97.62
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 97.61
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 97.6
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 97.6
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 97.59
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 97.59
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 97.58
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 97.57
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 97.54
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 97.54
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 97.52
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 97.51
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 97.48
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 97.47
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 97.43
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 97.38
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 97.35
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 97.31
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 97.27
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 97.25
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 97.21
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 97.17
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 97.15
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 97.06
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Bruton's tyrosine kinase (Btk)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.49  E-value=6e-08  Score=67.87  Aligned_cols=50  Identities=28%  Similarity=0.373  Sum_probs=40.7

Q ss_pred             cCccccceeecCCCcceEEEEeCCCCEEEEEEecCCCCCChHHHHHHHhhC
Q 043043          104 HNFDRKLVMGKGAFGNVYRGTLRNSMKVAVKRGETGSGQGLPEFQTAIIVL  154 (154)
Q Consensus       104 ~~f~~~~~iG~g~~g~vy~g~l~~g~~vaVK~l~~~~~~~~~~f~~e~~~l  154 (154)
                      ++|...+.||+|+||+||+|+.+++..||||.+... ....++|.+|+.++
T Consensus         4 ~~~~~~~~iG~G~fg~Vy~~~~~~~~~vAvK~l~~~-~~~~~~~~~Ev~~~   53 (258)
T d1k2pa_           4 KDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEG-SMSEDEFIEEAKVM   53 (258)
T ss_dssp             CCCCCCCCCCEETTEEEEEEEETTTEEEEEEEEESS-SSCHHHHHHHHHHH
T ss_pred             HHCEEeEEEecCCCeEEEEEEECCCCEEEEEEECcC-cCCHHHHHHHHHHH
Confidence            356666789999999999999988889999999643 33467899998753



>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure