Citrus Sinensis ID: 043080


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MEAEEHEIELADKEAFSDEFKCCVCLELLYKPVVLACGHISCFWCVYNAMNSWHESNCPVCRNPYNHFPSICHLLHFLLKKLYPLTYEKRERQVAEEEKQLGHFSPQVGYNLFGSPTNKEVDILGKSLDSPSQQQIKLYSESRFSGEGKSSPCMKSLEMTAESGDDAMLKLVTSSECSEATANSTAQECGLVGNDLEHKAENWVSVDDLSCAACKKMLFKPVVLNCGHVFCELCLFVPEDGNFKCPNCQSLQPYGLPSVCLIIEHFLEERFSDLYAERKEALLKQTSGATQARHRKNRSASFPKLVYASLWLGNGPKIHFGVGCDYCGMSPIIGERYKCKDCVESIGFDLCEACHNNPAKVPGRFNQQHKPEHKFEIMQPTSLSDLINRINSDMSDDEGSDATENRDGVARTGDLSGDVPEDPENDTNDLEDASSCFLPVDASLDPQDDSDERSSDFP
cccHHHHHccHHHcccccccccHHHHHHcccccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHcccccCCccccccccHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccccccccccccccccccccccCCccccccccccccccccCEECcccccccccccHHHHHcccccccccccccccccccEEEcccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**************AFSDEFKCCVCLELLYKPVVLACGHISCFWCVYNAMNSWHESNCPVCRNPYNHFPSICHLLHFLLKKLYPLTYEK**************FSPQVGYNLFGSPTNKEVDILGKSLDSPSQQQIKLYSE***********CMKSLEMTAESGDDAMLKLV**************QECGLVGNDLEHKAENWVSVDDLSCAACKKMLFKPVVLNCGHVFCELCLFVPEDGNFKCPNCQSLQPYGLPSVCLIIEHFLEERFSDLYAER**************************LVYASLWLGNGPKIHFGVGCDYCGMSPIIGERYKCKDCVESIGFDLCEACHNNPA**********KPEHKFEIMQPTSLSDL***********************ARTGDLSGDV***************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAEEHEIELADKEAFSDEFKCCVCLELLYKPVVLACGHISCFWCVYNAMNSWHESNCPVCRNPYNHFPSICHLLHFLLKKLYPLTYEKRERQVAEEEKQLGHFSPQVGYNLFGSPTNKEVDILGKSLDSPSQQQIKLYSESRFSGEGKSSPCMKSLEMTAESGDDAMLKLVTSSECSEATANSTAQECGLVGNDLEHKAENWVSVDDLSCAACKKMLFKPVVLNCGHVFCELCLFVPEDGNFKCPNCQSLQPYGLPSVCLIIEHFLEERFSDLYAERKEALLKQTSGATQARHRKNRSASFPKLVYASLWLGNGPKIHFGVGCDYCGMSPIIGERYKCKDCVESIGFDLCEACHNNPAKVPGRFNQQHKPEHKFEIMQPTSLSDLINRINSDMSDDEGSDATENRDGVARTGDLSGDVPEDPENDTNDLEDASSCFLPVDASLDPQDDSDERSSDFP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase PRT1 E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. Functions in the N-end rule pathway of protein degradation, where it specifically recognizes and ubiquitinates proteins with a N-terminal bulky aromatic amino acid. Does not act on aliphatic hydrophobic and basic N-terminal residues containing proteins.probableQ8LBL5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ECW, chain A
Confidence level:very confident
Coverage over the Query: 205-265
View the alignment between query and template
View the model in PyMOL
Template: 2ECW, chain A
Confidence level:very confident
Coverage over the Query: 12-67
View the alignment between query and template
View the model in PyMOL
Template: 3L11, chain A
Confidence level:very confident
Coverage over the Query: 13-95
View the alignment between query and template
View the model in PyMOL
Template: 2FC7, chain A
Confidence level:very confident
Coverage over the Query: 308-380
View the alignment between query and template
View the model in PyMOL