Citrus Sinensis ID: 043080
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 458 | ||||||
| 224072665 | 469 | predicted protein [Populus trichocarpa] | 0.930 | 0.908 | 0.496 | 1e-111 | |
| 255554142 | 424 | conserved hypothetical protein [Ricinus | 0.783 | 0.846 | 0.512 | 1e-105 | |
| 225465447 | 470 | PREDICTED: E3 ubiquitin-protein ligase P | 0.855 | 0.834 | 0.430 | 2e-89 | |
| 297744343 | 451 | unnamed protein product [Vitis vinifera] | 0.810 | 0.822 | 0.430 | 6e-84 | |
| 356566399 | 421 | PREDICTED: E3 ubiquitin-protein ligase P | 0.877 | 0.954 | 0.423 | 1e-83 | |
| 118486134 | 469 | unknown [Populus trichocarpa] | 0.868 | 0.848 | 0.413 | 2e-82 | |
| 255560167 | 399 | conserved hypothetical protein [Ricinus | 0.770 | 0.884 | 0.416 | 2e-82 | |
| 224065338 | 382 | predicted protein [Populus trichocarpa] | 0.768 | 0.921 | 0.45 | 2e-80 | |
| 356524509 | 394 | PREDICTED: E3 ubiquitin-protein ligase P | 0.834 | 0.969 | 0.396 | 2e-80 | |
| 297831360 | 417 | hypothetical protein ARALYDRAFT_479998 [ | 0.810 | 0.889 | 0.408 | 1e-79 |
| >gi|224072665|ref|XP_002303829.1| predicted protein [Populus trichocarpa] gi|222841261|gb|EEE78808.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 409 bits (1051), Expect = e-111, Method: Compositional matrix adjust.
Identities = 221/445 (49%), Positives = 292/445 (65%), Gaps = 19/445 (4%)
Query: 7 EIELADKEAFSDEFKCCVCLELLYKPVVLACGHISCFWCVYNAMNSWHESNCPVCRNPYN 66
E + ++E F DEF+C VCL+LLYKPVVL CGH+SCFWCV+ +MN ES+CP+CR+ +N
Sbjct: 38 EDNVREEEDFLDEFQCSVCLDLLYKPVVLGCGHLSCFWCVFYSMNGLRESHCPICRHQFN 97
Query: 67 HFPSICHLLHFLLKKLYPLTYEKRERQVAEEEKQLGHFSPQVGYNLFGSPTNKEVDILGK 126
HFPS+C LLHFLL K+YP+ Y++RER+V EEEK+ G FSPQ ++ FGS + +E+D
Sbjct: 98 HFPSVCQLLHFLLMKMYPIAYKRREREVGEEEKKGGRFSPQFVHHPFGSHSGEELDFPSY 157
Query: 127 SLDSPSQQQIKLYSESRFSGEGKSSPCMKSLEMTAESGDDAMLKLVTSSECSEATANSTA 186
S P Q KL + A ++ + T S S+ T N+
Sbjct: 158 SQHFPIHPQNKLCYFPK---------------AIAHREENMKIVPSTLSSRSDGTTNAAI 202
Query: 187 QECGLVGNDLEHKAENWVSVDDLSCAACKKMLFKPVVLNCGHVFCELCLFVPEDGNFKCP 246
+ C L+G + H + SV DL CA CKK+LF+PVVLNCGHV+CE C+ P G +C
Sbjct: 203 ENCNLIGTEFGHGIKTQASVADLLCAECKKLLFQPVVLNCGHVYCESCIASPMQGIPRCQ 262
Query: 247 NCQSLQPYGLPSVCLIIEHFLEERFSDLYAERKEALLKQT--SGATQARHRKNRSASFPK 304
CQSL P G+PSVCL++EHFLEE+FS++YAER+EA KQT S + Q + +S+S P
Sbjct: 263 ICQSLHPNGIPSVCLVLEHFLEEQFSEIYAERREAFAKQTDCSSSAQTQQLATQSSSVPA 322
Query: 305 LVYASLWLGNGPKIHFGVGCDYCGMSPIIGERYKCKDCVESIGFDLCEACHNNPAKVPGR 364
VY+S GNGPK+H VGCD CGM PIIGERYKCKDC E IGFD+CE+C+NNP++V GR
Sbjct: 323 KVYSSWIFGNGPKVHIRVGCDSCGMIPIIGERYKCKDCSEEIGFDMCESCYNNPSEVSGR 382
Query: 365 FNQQHKPEHKFEIMQPTSLSDLINRINSDMSDDEGSDATENRDGVARTGDLSGDVPEDPE 424
FNQQHKPEH FEI+ P + + I +N D SDD + D +A+ LS D +D E
Sbjct: 383 FNQQHKPEHNFEIVPPRGIGEFIYMLNLDQSDDTDDSDDDGHDFLAQV--LSDDALQDVE 440
Query: 425 NDTNDLEDASSCFLPVDASLDPQDD 449
+ +NDL + S+ L VD + D +DD
Sbjct: 441 DGSNDLLEVSALVLSVDVAPDQEDD 465
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255554142|ref|XP_002518111.1| conserved hypothetical protein [Ricinus communis] gi|223542707|gb|EEF44244.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225465447|ref|XP_002266086.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297744343|emb|CBI37313.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356566399|ref|XP_003551419.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|118486134|gb|ABK94910.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255560167|ref|XP_002521101.1| conserved hypothetical protein [Ricinus communis] gi|223539670|gb|EEF41252.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224065338|ref|XP_002301781.1| predicted protein [Populus trichocarpa] gi|222843507|gb|EEE81054.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356524509|ref|XP_003530871.1| PREDICTED: E3 ubiquitin-protein ligase PRT1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297831360|ref|XP_002883562.1| hypothetical protein ARALYDRAFT_479998 [Arabidopsis lyrata subsp. lyrata] gi|297329402|gb|EFH59821.1| hypothetical protein ARALYDRAFT_479998 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 458 | ||||||
| TAIR|locus:2087278 | 410 | PRT1 "proteolysis 1" [Arabidop | 0.563 | 0.629 | 0.376 | 1.1e-80 | |
| ZFIN|ZDB-GENE-101021-4 | 605 | lonrf1 "LON peptidase N-termin | 0.349 | 0.264 | 0.255 | 7.8e-10 | |
| UNIPROTKB|F1NWA3 | 579 | F1NWA3 "Uncharacterized protei | 0.222 | 0.176 | 0.354 | 1.8e-09 | |
| UNIPROTKB|F1PSB6 | 765 | LONRF3 "Uncharacterized protei | 0.349 | 0.209 | 0.294 | 1.1e-08 | |
| TAIR|locus:2035025 | 491 | AT1G18660 [Arabidopsis thalian | 0.157 | 0.146 | 0.381 | 1.6e-08 | |
| UNIPROTKB|F1P3J6 | 597 | Gga.40071 "Uncharacterized pro | 0.187 | 0.144 | 0.333 | 2.1e-08 | |
| MGI|MGI:1921615 | 753 | Lonrf3 "LON peptidase N-termin | 0.401 | 0.244 | 0.278 | 3e-08 | |
| UNIPROTKB|H3BRQ5 | 109 | BFAR "Bifunctional apoptosis r | 0.165 | 0.697 | 0.341 | 1e-07 | |
| UNIPROTKB|F1P5G6 | 753 | LONRF2 "Uncharacterized protei | 0.331 | 0.201 | 0.25 | 2.2e-07 | |
| UNIPROTKB|G3MWZ9 | 844 | TRIM34 "Uncharacterized protei | 0.104 | 0.056 | 0.396 | 2.6e-07 |
| TAIR|locus:2087278 PRT1 "proteolysis 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 489 (177.2 bits), Expect = 1.1e-80, Sum P(2) = 1.1e-80
Identities = 104/276 (37%), Positives = 148/276 (53%)
Query: 145 SGEGKSSPCMKSLEMTAESGDDAMLKLVTSSECSEATANSTAQECGLVGNDL--EHKAEN 202
S + K C + + + S + + ++ E T A+ + N+L ++K
Sbjct: 129 SDKQKVEECSNAANLLSSSSSRGDIPCIPKNQ--EPT---DAKALNVHENELLKDNKVSK 183
Query: 203 WVSVDDLSCAACKKMLFKPVVLNCGHVFCELCL--FVPEDGNFKCPNCQSLQPYGLPSVC 260
+S DDL C+ACK++L +PVVLNCGHV+CE C+ E KC C P G P VC
Sbjct: 184 QISKDDLLCSACKELLVRPVVLNCGHVYCEGCVVDMAEESEKIKCQECNVCDPRGFPKVC 243
Query: 261 LIIEHFLEERFSDLYAER----KEALLKQTSGATQARHRKNRSASFPKLVYASLWLGN-G 315
LI+E LEE F + Y R ++ L + G Q+ ++ S S WL N G
Sbjct: 244 LILEQLLEENFPEEYNSRSSKVQKTLAHNSKGNIQSYLKEGPSLSNDNN-NDDPWLANPG 302
Query: 316 PKIHFGVGCDYCGMSPIIGERYKCKDCVESIGFDLCEACHNNPAKVPGRFNQQHKPEHKF 375
+HFG GCD CG+ PIIG+RY+CKDC E IG+DLC+ C+ P+KVPGRFNQQH P+H+
Sbjct: 303 SNVHFGAGCDSCGVYPIIGDRYRCKDCKEEIGYDLCKDCYETPSKVPGRFNQQHTPDHRL 362
Query: 376 EIMQPTSLSDLINRIN---SDMSDDEGSDATENRDG 408
E+ + + N I + +EG D E +G
Sbjct: 363 ELARSPQVLINFNSIGILLGPVISNEGMDTDEGEEG 398
|
|
| ZFIN|ZDB-GENE-101021-4 lonrf1 "LON peptidase N-terminal domain and ring finger 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NWA3 F1NWA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PSB6 LONRF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035025 AT1G18660 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3J6 Gga.40071 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1921615 Lonrf3 "LON peptidase N-terminal domain and ring finger 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BRQ5 BFAR "Bifunctional apoptosis regulator" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P5G6 LONRF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MWZ9 TRIM34 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 458 | |||
| cd02338 | 49 | cd02338, ZZ_PCMF_like, Zinc finger, ZZ type | 3e-09 | |
| cd02249 | 46 | cd02249, ZZ, Zinc finger, ZZ type | 4e-07 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 5e-07 | |
| cd02341 | 48 | cd02341, ZZ_ZZZ3, Zinc finger, ZZ type | 1e-06 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 3e-06 | |
| cd02339 | 45 | cd02339, ZZ_Mind_bomb, Zinc finger, ZZ type | 3e-05 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 7e-05 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 9e-05 | |
| cd02344 | 45 | cd02344, ZZ_HERC2, Zinc finger, ZZ type | 2e-04 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 4e-04 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 5e-04 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 7e-04 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 8e-04 | |
| pfam00569 | 46 | pfam00569, ZZ, Zinc finger, ZZ type | 8e-04 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 9e-04 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 0.001 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 0.001 | |
| cd02334 | 49 | cd02334, ZZ_dystrophin, Zinc finger, ZZ type | 0.001 | |
| cd02335 | 49 | cd02335, ZZ_ADA2, Zinc finger, ZZ type | 0.001 | |
| cd02340 | 43 | cd02340, ZZ_NBR1_like, Zinc finger, ZZ type | 0.001 | |
| COG5152 | 259 | COG5152, COG5152, Uncharacterized conserved protei | 0.002 | |
| COG5222 | 427 | COG5222, COG5222, Uncharacterized conserved protei | 0.002 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 0.003 |
| >gnl|CDD|239078 cd02338, ZZ_PCMF_like, Zinc finger, ZZ type | Back alignment and domain information |
|---|
Score = 52.3 bits (126), Expect = 3e-09
Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 8/55 (14%)
Query: 322 VGCDYCGMSPIIGERYKCKDCVESIGFDLCEACHNNPAKVPGRFNQQHKPEHKFE 376
V CD CG S G RYKC C +DLC C+++ ++H +H +
Sbjct: 1 VSCDGCGKSNFTGRRYKCLIC---YDYDLCADCYDSGVT-----TERHLFDHPMQ 47
|
Zinc finger present in potassium channel modulatory factor (PCMF) 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel modulatory factor 1 or FIGC has been shown to possess intrinsic E3 ubiquitin ligase activity and to promote ubiquitination. Length = 49 |
| >gnl|CDD|239069 cd02249, ZZ, Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|239081 cd02341, ZZ_ZZZ3, Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|239079 cd02339, ZZ_Mind_bomb, Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|239084 cd02344, ZZ_HERC2, Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|144236 pfam00569, ZZ, Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
| >gnl|CDD|239074 cd02334, ZZ_dystrophin, Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >gnl|CDD|239075 cd02335, ZZ_ADA2, Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >gnl|CDD|239080 cd02340, ZZ_NBR1_like, Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 458 | |||
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 99.31 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.27 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.14 | |
| cd02344 | 45 | ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present | 99.11 | |
| cd02334 | 49 | ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr | 99.09 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.08 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.07 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.94 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.94 | |
| cd02339 | 45 | ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre | 98.93 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.86 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.85 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.85 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.85 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.84 | |
| cd02341 | 48 | ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present | 98.84 | |
| cd02338 | 49 | ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre | 98.84 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.84 | |
| cd02340 | 43 | ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre | 98.8 | |
| cd02342 | 43 | ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre | 98.8 | |
| cd02345 | 49 | ZZ_dah Zinc finger, ZZ type. Zinc finger present i | 98.79 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.79 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.78 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.76 | |
| PF00569 | 46 | ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc | 98.74 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.71 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 98.71 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.7 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.68 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.67 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.67 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.66 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.66 | |
| cd02343 | 48 | ZZ_EF Zinc finger, ZZ type. Zinc finger present in | 98.62 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.6 | |
| cd02335 | 49 | ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present | 98.58 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.58 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.57 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.57 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.53 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.53 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.51 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.51 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.5 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.5 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.5 | |
| cd02249 | 46 | ZZ Zinc finger, ZZ type. Zinc finger present in dy | 98.5 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.48 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.44 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.44 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.44 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.42 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.41 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.4 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.37 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.36 | |
| smart00291 | 44 | ZnF_ZZ Zinc-binding domain, present in Dystrophin, | 98.35 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.32 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.3 | |
| KOG4582 | 278 | consensus Uncharacterized conserved protein, conta | 98.29 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.28 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 98.26 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.25 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.24 | |
| KOG1280 | 381 | consensus Uncharacterized conserved protein contai | 98.23 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.21 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.11 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.04 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.04 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.98 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.95 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 97.94 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.94 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.93 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.9 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.9 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.9 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.86 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.82 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.78 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.77 | |
| cd02337 | 41 | ZZ_CBP Zinc finger, ZZ type. Zinc finger present i | 97.74 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.73 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.67 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.62 | |
| KOG4286 | 966 | consensus Dystrophin-like protein [Cell motility; | 97.6 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.57 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.45 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.4 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.38 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.37 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.36 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.33 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.3 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.3 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.29 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.27 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.19 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.17 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.16 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.1 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.1 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.01 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.93 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.69 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 96.66 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 96.64 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.5 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.22 | |
| KOG4301 | 434 | consensus Beta-dystrobrevin [Cytoskeleton] | 96.18 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.17 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.15 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.05 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.01 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 95.94 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.87 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 95.85 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 95.82 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 95.81 | |
| cd02336 | 45 | ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present | 95.8 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 95.79 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.58 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 95.52 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 95.5 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 95.49 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 95.38 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 95.35 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 95.34 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 95.28 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.21 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.11 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 95.11 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 95.05 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 94.79 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 94.78 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 94.76 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 94.76 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 94.74 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 94.72 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 94.71 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 94.69 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.43 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 94.43 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 94.34 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.33 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.28 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.0 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 93.97 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.94 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 93.9 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.79 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.79 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 93.69 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.42 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 93.39 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 93.24 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.19 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 93.08 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.9 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 92.81 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 92.74 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.62 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 92.57 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.54 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 92.53 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 92.46 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 92.21 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 91.67 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 90.96 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 90.69 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 90.57 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 90.57 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.13 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 90.07 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 89.77 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.73 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 89.7 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 89.69 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 89.67 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.55 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.02 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 88.94 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 88.9 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.9 | |
| PF06524 | 314 | NOA36: NOA36 protein; InterPro: IPR010531 This fam | 88.82 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 88.78 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 88.75 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 88.51 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 88.45 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 88.37 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 87.98 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.91 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 87.78 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 87.02 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.02 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 86.3 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 85.97 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 85.73 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.7 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 85.43 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 85.4 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.05 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 84.84 | |
| PF00643 | 42 | zf-B_box: B-box zinc finger; InterPro: IPR000315 Z | 83.45 | |
| PHA02862 | 156 | 5L protein; Provisional | 83.1 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 81.89 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 80.35 | |
| PHA03096 | 284 | p28-like protein; Provisional | 80.28 |
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Probab=99.31 E-value=5.2e-12 Score=115.67 Aligned_cols=108 Identities=12% Similarity=0.008 Sum_probs=71.7
Q ss_pred CcccccccccccCCCchhhhhhhhccccccccccchhhhcCCCCCchhhhh-hccCCCCCcccccccccCCCce---Ec-
Q 043080 150 SSPCMKSLEMTAESGDDAMLKLVTSSECSEATANSTAQECGLVGNDLEHKA-ENWVSVDDLSCAACKKMLFKPV---VL- 224 (458)
Q Consensus 150 ~~~~~~~~ps~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~l~C~iC~~~~~~pv---~l- 224 (458)
++|+....|.+.....++|..-+..+.++.....+.+..+.|+..+-.... ........+.||||...|.+.+ +|
T Consensus 162 sFWlPs~tP~A~atklekP~~~v~CP~s~kplklkdL~~VkFT~l~s~~~et~l~a~s~ryiCpvtrd~LtNt~~ca~Lr 241 (303)
T KOG3039|consen 162 SFWLPSLTPTAAATKLEKPSTTVVCPVSGKPLKLKDLFAVKFTPLNSEETETKLIAASKRYICPVTRDTLTNTTPCAVLR 241 (303)
T ss_pred ceecCccCchhhhhcccCCCceeeccCCCCccchhhcceeeeeecCCchhhhhhhhhccceecccchhhhcCccceEEec
Confidence 366655566554444444444444444443334556777777665532222 1122337899999999999753 23
Q ss_pred ccCchhhHhhhhhccCCCCCCCCCccCCCCCCc
Q 043080 225 NCGHVFCELCLFVPEDGNFKCPNCQSLQPYGLP 257 (458)
Q Consensus 225 ~CgH~fC~~Cl~~~~~~~~~CP~Cr~~~~~~~~ 257 (458)
+|||+||..|++.++...+.||+|..++..+.+
T Consensus 242 ~sg~Vv~~ecvEklir~D~v~pv~d~plkdrdi 274 (303)
T KOG3039|consen 242 PSGHVVTKECVEKLIRKDMVDPVTDKPLKDRDI 274 (303)
T ss_pred cCCcEeeHHHHHHhccccccccCCCCcCcccce
Confidence 999999999999999999999999998876543
|
|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >cd02344 ZZ_HERC2 Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02334 ZZ_dystrophin Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >cd02339 ZZ_Mind_bomb Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >cd02341 ZZ_ZZZ3 Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02338 ZZ_PCMF_like Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >cd02340 ZZ_NBR1_like Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02342 ZZ_UBA_plant Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >cd02345 ZZ_dah Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >cd02343 ZZ_EF Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02335 ZZ_ADA2 Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >cd02249 ZZ Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02337 ZZ_CBP Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4301 consensus Beta-dystrobrevin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >cd02336 ZZ_RSC8 Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 458 | ||||
| 2fc7_A | 82 | Solution Structure Of The Zz Domain Of Zzz3 Protein | 7e-04 | ||
| 2ecw_A | 85 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 8e-04 |
| >pdb|2FC7|A Chain A, Solution Structure Of The Zz Domain Of Zzz3 Protein Length = 82 | Back alignment and structure |
|
| >pdb|2ECW|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Tripartite Motif Protein 30 Length = 85 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 458 | |||
| 2fc7_A | 82 | ZZZ3 protein; structure genomics, ZZ domain, struc | 9e-17 | |
| 2dip_A | 98 | Zinc finger SWIM domain-containing protein 2; ZZ d | 1e-15 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 3e-13 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 2e-08 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 4e-11 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 9e-08 | |
| 2e5r_A | 63 | Dystrobrevin alpha; ZZ domain, structural genomics | 4e-11 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 9e-11 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 4e-10 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 1e-10 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 1e-07 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 4e-10 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 2e-05 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 9e-10 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 4e-07 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 1e-09 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 3e-06 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 2e-09 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 1e-05 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 2e-09 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 6e-07 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 3e-09 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 9e-06 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 7e-09 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 8e-06 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 1e-08 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 7e-05 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 1e-08 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 5e-06 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 1e-08 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 4e-05 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 2e-08 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 9e-08 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 3e-08 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 4e-05 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 3e-08 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 9e-07 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 3e-08 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 3e-06 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 6e-08 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 2e-06 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 8e-08 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 7e-04 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 2e-07 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 2e-07 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 1e-05 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 2e-07 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 2e-07 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 3e-07 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 3e-07 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 5e-06 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 3e-07 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 4e-06 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 4e-07 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 5e-04 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 6e-07 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 3e-05 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 1e-06 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 2e-04 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 2e-06 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 4e-06 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 2e-05 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 9e-06 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-05 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 3e-05 | |
| 1tot_A | 52 | CREB-binding protein; zinc binding, CBP, TAZ2, tra | 3e-05 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 9e-05 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 1e-04 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 3e-04 |
| >2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 Length = 82 | Back alignment and structure |
|---|
Score = 73.9 bits (181), Expect = 9e-17
Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 5/59 (8%)
Query: 318 IHFGVGCDYCGMSPIIGERYKCKDCVESIGFDLCEACHNNPAKVPGRFNQQHKPEHKFE 376
H G CD CG+ PI G R+ C+DC + D C++C + + HK +H+ E
Sbjct: 18 QHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHE-----TDIHKEDHQLE 71
|
| >2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 Length = 98 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 Length = 52 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 458 | |||
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.73 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.39 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.38 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.37 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.34 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.34 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.34 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.33 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.33 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.32 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.32 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.32 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.32 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.29 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.29 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.28 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.27 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.26 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.26 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.23 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.23 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.22 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.22 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.2 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.19 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.19 | |
| 2fc7_A | 82 | ZZZ3 protein; structure genomics, ZZ domain, struc | 99.19 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.19 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.19 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.17 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.17 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.16 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.16 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.16 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.15 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.14 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.13 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.13 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.13 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.13 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.12 | |
| 2e5r_A | 63 | Dystrobrevin alpha; ZZ domain, structural genomics | 99.09 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.09 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.09 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.09 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.09 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.08 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.07 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.07 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.07 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.07 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.07 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.05 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.04 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.04 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.04 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.03 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.02 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.02 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.01 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.01 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.01 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.01 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.99 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.98 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.98 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.98 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.97 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.96 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.96 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.95 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.95 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.94 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.94 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.94 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.93 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.93 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.93 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.92 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.92 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.91 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.9 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.9 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.89 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.89 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.89 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.89 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.88 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.88 | |
| 2dip_A | 98 | Zinc finger SWIM domain-containing protein 2; ZZ d | 98.88 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.87 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.87 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.86 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.86 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.85 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.85 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.83 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.83 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.82 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.81 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.81 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.8 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.8 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.8 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.79 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.75 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.74 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.71 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.68 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.64 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.62 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.62 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.62 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.57 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.54 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.53 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.51 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.49 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.49 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.44 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.43 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.42 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.41 | |
| 1tot_A | 52 | CREB-binding protein; zinc binding, CBP, TAZ2, tra | 98.4 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.4 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.38 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.38 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.38 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.37 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.27 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.24 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.22 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.17 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.16 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.1 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.97 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.89 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.62 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.62 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.43 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 97.11 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.1 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 96.88 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 96.51 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 95.81 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 95.64 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 95.21 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 95.14 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 93.92 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 93.2 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 92.38 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 87.58 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 86.46 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 85.25 | |
| 2ffw_A | 78 | Midline-1; B-BOX, ring finger, zinc-finger, ligase | 83.23 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 83.07 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 80.86 |
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=99.73 E-value=3.2e-19 Score=153.69 Aligned_cols=49 Identities=31% Similarity=0.638 Sum_probs=43.5
Q ss_pred CCcccccccccCCCc-------eEcccCchhhHhhhhhccCCCCCCCCCccCCCCC
Q 043080 207 DDLSCAACKKMLFKP-------VVLNCGHVFCELCLFVPEDGNFKCPNCQSLQPYG 255 (458)
Q Consensus 207 ~~l~C~iC~~~~~~p-------v~l~CgH~fC~~Cl~~~~~~~~~CP~Cr~~~~~~ 255 (458)
+.+.|+||++.|..| +.++|||+||..|+.+|+.....||+||..+...
T Consensus 71 ~~~~C~iC~~~~~~~~~~~~~~~~~~CgH~fc~~Ci~~~~~~~~~CP~Cr~~~~~~ 126 (133)
T 4ap4_A 71 GTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHK 126 (133)
T ss_dssp SSCBCTTTCCBHHHHHHTTCCEEEETTSBEEEHHHHHHHHHHCSBCTTTCCBCCGG
T ss_pred CCCCCCCCCCccccccccCcceEeCCCCChhhHHHHHHHHHcCCCCCCCCCcCChh
Confidence 345699999999887 8889999999999999999889999999988654
|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >2ffw_A Midline-1; B-BOX, ring finger, zinc-finger, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 458 | ||||
| d2fc7a1 | 69 | g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing p | 7e-14 | |
| d2dipa1 | 85 | g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing p | 4e-13 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 8e-09 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 1e-05 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 3e-08 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 9e-05 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 6e-08 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 0.001 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 6e-07 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-05 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 2e-06 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 0.004 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-05 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 5e-05 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 5e-04 | |
| d1tota1 | 52 | g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse | 5e-04 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 6e-04 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 0.001 |
| >d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: ZZ domain domain: Zinc finger ZZ-type-containing protein 3, ZZZ3 species: Human (Homo sapiens) [TaxId: 9606]
Score = 63.9 bits (155), Expect = 7e-14
Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 5/59 (8%)
Query: 318 IHFGVGCDYCGMSPIIGERYKCKDCVESIGFDLCEACHNNPAKVPGRFNQQHKPEHKFE 376
H G CD CG+ PI G R+ C+DC + D C++C + HK +H+ E
Sbjct: 11 QHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDC-----LHETDIHKEDHQLE 64
|
| >d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 458 | |||
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.37 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.36 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.28 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.27 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.27 | |
| d2fc7a1 | 69 | Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu | 99.25 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.25 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.24 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.22 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.19 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.14 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.1 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.05 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.04 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.01 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.01 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.0 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.98 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.97 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.94 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.88 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.87 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.87 | |
| d2dipa1 | 85 | Zinc finger ZZ-type-containing protein 2 {Human (H | 98.86 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.85 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.78 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.74 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.6 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.5 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.44 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.33 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.28 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.14 | |
| d1tota1 | 52 | CREB-binding protein, CBP {Mouse (Mus musculus) [T | 98.05 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.67 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.66 | |
| d2djaa1 | 71 | Midline-2 {Human (Homo sapiens) [TaxId: 9606]} | 88.36 | |
| d2d8ua1 | 51 | Ubiquitin ligase trim63 {Human (Homo sapiens) [Tax | 87.28 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 86.16 | |
| d1v5na_ | 89 | Pdi-like hypothetical protein At1g60420 {Thale cre | 82.89 | |
| d2dq5a1 | 47 | Midline-1 {Human (Homo sapiens) [TaxId: 9606]} | 82.01 |
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.37 E-value=7.7e-14 Score=107.44 Aligned_cols=66 Identities=11% Similarity=0.014 Sum_probs=59.9
Q ss_pred CCCcccccccccCCCceEcccCchhhHhhhhhccC-CCCCCCCCccCCCCCCchhhHHHHHHHHHhh
Q 043080 206 VDDLSCAACKKMLFKPVVLNCGHVFCELCLFVPED-GNFKCPNCQSLQPYGLPSVCLIIEHFLEERF 271 (458)
Q Consensus 206 ~~~l~C~iC~~~~~~pv~l~CgH~fC~~Cl~~~~~-~~~~CP~Cr~~~~~~~~~~~~~l~~l~~~~~ 271 (458)
.++|.||||+++|.+||+++|||+||+.||..|+. ....||.|+..+....+.+|..|+++++.|.
T Consensus 5 P~~l~CpIc~~l~~dPv~~~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~~~~l~pN~~L~~~I~~~l 71 (80)
T d2c2la2 5 PDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFI 71 (80)
T ss_dssp CSTTBCTTTCSBCSSEEECSSCCEEETTHHHHHHHHTCSSCTTTCCCCCGGGCEECHHHHHHHHHHH
T ss_pred CccccCcCcCchhhhhcccCCcCeecHHHHHHHHhcCCccCCCccccccccccccHHHHHHHHHHHH
Confidence 36899999999999999999999999999999986 5678999999988777888999999999874
|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djaa1 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ua1 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2dq5a1 g.43.1.1 (A:168-214) Midline-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|