Citrus Sinensis ID: 043106

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MVPKLSTHLQKVLLTLANEAGHGHGQRLGHSHGFSDGDEESGVWHVVVSQVLELGIVSHSIIIGISLGVSHSPCTIRPLIAALSFHQFFEGFALGGCIWQAQFNTQSATLMACFFRLNNSSRDQHRYCSCFSLQPKQPRCSDC
cccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccccEEHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
****************************************SGVWHVVVSQVLELGIVSHSIIIGISLGVSHSPCTIRPLIAALSFHQFFEGFALGGCIWQAQFNTQSATLMACFFRLNNSSRDQHRYCSCFS***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVPKLSTHLQKVLLTLANEAGHGHGQRLGHSHGFSDGDEESGVWHVVVSQVLELGIVSHSIIIGISLGVSHSPCTIRPLIAALSFHQFFEGFALGGCIWQAQFNTQSATLMACFFRLNNSSRDQHRYCSCFSLQPKQPRCSDC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc transporter 4, chloroplastic May play a role in the transport of zinc in the plastids. Could also transport copper ions.probableO04089
Zinc transporter 7 Zinc transporter that may be involved in zinc uptake from the rhizosphere.probableQ6L8F7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted