Citrus Sinensis ID: 043131


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590--
MKREHSQLDPPPPPPSCLAGPSGKGKMWEEEQTDGGGMDELLAVLGYNVRSSDMVEVAQKIEQLEEAMGAFQADGINHLATDTVHYDPSNLCTWLESMLTEFNPTMPAGLGLDPVPAPSVFDDSSFVAPAESSTITSLDFSHQRVLEEPSTSDYDLKAIPGKAMYGANNSQNSSNNYLSLSSASASSLSSSTTTRENKRLKTSEFYPPESTRPIVLADSQENGIRLVHALMACAEAVQQNNLTLAEAFVKQIRFLAVSQAGAMGKVATHFAEALARRIYGLYPQSPIDHSFSELLEMQFYETCPYLKFAHFTANQAILEAFDGKRRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPAADNTDQLQQVGWKLAQLAESIHVEFEYRGFVANSLADLDASMLEIKPSEVDSVAVNSVFELHKLLAQPGAIDKVLSVVKNIKPDIFTVAEQEANHNGPVFLDRFTESLHYYSTMFDSLEGSVNSPENHKAMTEAYMGNQICNVVACEGADRVERHETLAQWRTRFSSAGFIPAHIGSNAYKQASMLLALFAGGDGYKVEENNGCLTLGWYTRPLIATSAWKLAAKR
cccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHcccccEEEEEcccccccccHHHHHHHHccccccccEEEEECccccccccHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccEEEEEEEccccccccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccEEEECccEEEEECcccEEEEEEEccccccc
*************************************MDELLAVLGYNVRSSDMVEVAQKIEQLEEAMGAFQADGINHLATDTVHYDPSNLCTWLESMLTEFNPT******LDPVPAPSVFDD*******************************************************************************************VLADSQENGIRLVHALMACAEAVQQNNLTLAEAFVKQIRFLAVSQAGAMGKVATHFAEALARRIYGLYPQSPIDHSFSELLEMQFYETCPYLKFAHFTANQAILEAFDGKRRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPAADNTDQLQQVGWKLAQLAESIHVEFEYRGFVANSLADLDASMLEIKPSEVDSVAVNSVFELHKLLAQPGAIDKVLSVVKNIKPDIFTVAEQEANHNGPVFLDRFTESLHYYSTMFDSLEGSVNSPENHKAMTEAYMGNQICNVVACEGADRVERHETLAQWRTRFSSAGFIPAHIGSNAYKQASMLLALFAGGDGYKVEENNGCLTLGWYTRPLIATSAWKLAA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKREHSQLDPPPPPPSCLAGPSGKGKMWEEEQTDGGGMDELLAVLGYNVRSSDxxxxxxxxxxxxxxxxxxxxxGINHLATDTVHYDPSNLCTWLESMLTEFNPTMPAGLGLDPVPAPSVFDDSSFVAPAESSTITSLDFSHQRVLEEPSTSDYDLKAIPGKAMYGANNSQNSSNNYLSLSSASASSLSSSTTTRENKRLKTSEFYPPESTRPIVLADSQENGIRLVHALMACAEAVQQNNLTLAEAFVKQIRFLAVSQAGAMGKVATHFAEALARRIYGLYPQSPIDHSFSELLEMQFYETCPYLKFAHFTANQAILEAFDGKRRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPAADNTDQLQQVGWKLAQLAESIHVEFEYRGFVANSLADLDASMLEIKPSEVDSVAVNSVFELHKLLAQPGAIDKVLSVVKNIKPDIFTVAEQEANHNGPVFLDRFTESLHYYSTMFDSLEGSVNSPENHKAMTEAYMGNQICNVVACEGADRVERHETLAQWRTRFSSAGFIPAHIGSNAYKQASMLLALFAGGDGYKVEENNGCLTLGWYTRPLIATSAWKLAAKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DELLA protein GAI1 Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.probableQ8S4W7
DELLA protein RGA Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. Compared to other DELLA proteins, it is the most sensitive to GA application. Its activity is probably regulated by other phytohormones such as auxin and ethylene, attenuation of auxin transport delaying its GA-induced degradation.probableQ9SLH3
DELLA protein GAI Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that represses transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.probableQ84TQ7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZSH, chain B
Confidence level:very confident
Coverage over the Query: 37-102
View the alignment between query and template
View the model in PyMOL
Template: 4A6D, chain A
Confidence level:confident
Coverage over the Query: 314-466,478-483,499-541
View the alignment between query and template
View the model in PyMOL
Template: 3DTN, chain A
Confidence level:probable
Coverage over the Query: 315-494,505-541
View the alignment between query and template
View the model in PyMOL