Citrus Sinensis ID: 043269

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MDAHVGGFSSGNHRQQSEEAILGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGNITLQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQFRDAMRFVWVPRLIERIQAQSDSNSSGQPTSSTTTCTDNSTTTNHADLATSQ
cccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccc
cccccccccccccccccccHHcccccccccHHHHHHHHHHHHHcccccccHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHcccccHHHHcccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccc
mdahvggfssgnhrqqseeailgvrkgpwtveedSLLMNYVAIHGEGRwnavassaglnrtgksCRLRWLnylrpdvrrgniTLQEQLMILELHSRWGNRWSKIAqylpgrtdneikNYWRTRVQKHAKQLKCDVNSKQFRDAMRFVWVPRLIERIQaqsdsnssgqptsstttctdnstttnhadlatsq
mdahvggfssgnhrqqseeaILGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNylrpdvrrgniTLQEQLMILELHSRWGNRWSKIAQylpgrtdnEIKNYWRTRVQKHAkqlkcdvnskqfRDAMRFVWVPRLIERIqaqsdsnssgqptsstttctdnstttnhadlatsq
MDAHVGGFSSGNHRQQSEEAILGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGNITLQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQFRDAMRFVWVPRLIERIQAQsdsnssgqptsstttctdnstttnHADLATSQ
********************ILGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGNITLQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQFRDAMRFVWVPRLIERI***********************************
***********************VRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGNITLQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKH****************************************************************
****************SEEAILGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGNITLQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQFRDAMRFVWVPRLIERIQ*********************STTTNHADLATSQ
***************QSEEAILGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGNITLQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQF***************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAHVGGFSSGNHRQQSEEAILGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGNITLQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQFRDAMRFVWVPRLIERIQAQSDSNSSGQPTSSTTTCTDNSTTTNHADLATSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
P81391205 Myb-related protein 305 O N/A no 0.560 0.521 0.794 7e-49
Q9LK95226 Transcription factor MYB2 no no 0.560 0.473 0.775 1e-48
P81396198 Myb-related protein 340 O N/A no 0.560 0.540 0.777 2e-47
Q9LX82256 Transcription factor MYB4 no no 0.596 0.445 0.622 5e-39
Q4JL84235 Transcription factor MYB5 no no 0.565 0.459 0.648 1e-38
Q4JL76242 Myb-related protein MYBAS no no 0.570 0.450 0.614 9e-36
A2WW87 553 Transcription factor GAMY N/A no 0.539 0.186 0.572 1e-35
Q0JIC2 553 Transcription factor GAMY no no 0.539 0.186 0.572 1e-35
Q38850249 Transcription repressor M no no 0.811 0.622 0.449 6e-35
Q53NK6237 Myb-related protein MYBAS no no 0.586 0.472 0.580 9e-35
>sp|P81391|MYB05_ANTMA Myb-related protein 305 OS=Antirrhinum majus GN=MYB305 PE=2 SV=1 Back     alignment and function desciption
 Score =  193 bits (490), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 99/107 (92%)

Query: 24  VRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGNIT 83
           VRKGPWT+EED +L+NY+A HGEG WN++A SAGL RTGKSCRLRWLNYLRPDVRRGNIT
Sbjct: 13  VRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT 72

Query: 84  LQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQ 130
            +EQL+I+ELH++WGNRWSKIA+ LPGRTDNEIKNYWRTR+QKH +Q
Sbjct: 73  PEEQLLIMELHAKWGNRWSKIAKTLPGRTDNEIKNYWRTRIQKHMEQ 119
Transcription factor.
Antirrhinum majus (taxid: 4151)
>sp|Q9LK95|MYB21_ARATH Transcription factor MYB21 OS=Arabidopsis thaliana GN=MYB21 PE=1 SV=1 Back     alignment and function description
>sp|P81396|MYB40_ANTMA Myb-related protein 340 OS=Antirrhinum majus GN=MYB340 PE=2 SV=1 Back     alignment and function description
>sp|Q9LX82|MYB48_ARATH Transcription factor MYB48 OS=Arabidopsis thaliana GN=MYB48 PE=2 SV=1 Back     alignment and function description
>sp|Q4JL84|MYB59_ARATH Transcription factor MYB59 OS=Arabidopsis thaliana GN=MYB59 PE=2 SV=2 Back     alignment and function description
>sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa subsp. japonica GN=MYBAS2 PE=2 SV=1 Back     alignment and function description
>sp|A2WW87|GAM1_ORYSI Transcription factor GAMYB OS=Oryza sativa subsp. indica GN=GAM1 PE=2 SV=1 Back     alignment and function description
>sp|Q0JIC2|GAM1_ORYSJ Transcription factor GAMYB OS=Oryza sativa subsp. japonica GN=GAM1 PE=2 SV=1 Back     alignment and function description
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function description
>sp|Q53NK6|MYBA1_ORYSJ Myb-related protein MYBAS1 OS=Oryza sativa subsp. japonica GN=MYBAS1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
224112034 316 predicted protein [Populus trichocarpa] 0.900 0.544 0.726 2e-67
226500734 349 putative MYB DNA-binding domain superfam 0.848 0.464 0.722 4e-67
224099087 321 predicted protein [Populus trichocarpa] 0.732 0.436 0.828 4e-67
115452673 329 Os03g0315400 [Oryza sativa Japonica Grou 0.732 0.425 0.816 6e-67
125543626 329 hypothetical protein OsI_11306 [Oryza sa 0.732 0.425 0.816 7e-67
242035927 334 hypothetical protein SORBIDRAFT_01g03711 0.738 0.422 0.818 1e-66
222624813 310 hypothetical protein OsJ_10621 [Oryza sa 0.732 0.451 0.816 3e-66
226508924 336 putative MYB DNA-binding domain superfam 0.738 0.419 0.811 2e-65
115474203 300 Os07g0688200 [Oryza sativa Japonica Grou 0.874 0.556 0.683 2e-65
24059885 298 putative typical P-type R2R3 Myb protein 0.874 0.560 0.683 2e-65
>gi|224112034|ref|XP_002316060.1| predicted protein [Populus trichocarpa] gi|222865100|gb|EEF02231.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/172 (72%), Positives = 147/172 (85%)

Query: 18  EEAILGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDV 77
           EE ++ +R+GPWTVEED  L++Y+A HGEGRWN++A  AGL RTGKSCRLRWLNYLRPDV
Sbjct: 18  EEMMVDLRRGPWTVEEDFKLIDYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDV 77

Query: 78  RRGNITLQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNS 137
           RRGNITL+EQLMILELHSRWGNRWSKIAQ+LPGRTDNEIKNYWRTRVQKHAKQLKCDVNS
Sbjct: 78  RRGNITLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQLKCDVNS 137

Query: 138 KQFRDAMRFVWVPRLIERIQAQSDSNSSGQPTSSTTTCTDNSTTTNHADLAT 189
           KQF+D MR++W+PRLIERIQA + + SS   TS++   + N    N+ D+ T
Sbjct: 138 KQFKDTMRYLWMPRLIERIQAAAAATSSSTATSASPAASTNHHLINNNDVGT 189

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|226500734|ref|NP_001140397.1| putative MYB DNA-binding domain superfamily protein [Zea mays] gi|194699314|gb|ACF83741.1| unknown [Zea mays] gi|413955873|gb|AFW88522.1| putative MYB DNA-binding domain superfamily protein [Zea mays] Back     alignment and taxonomy information
>gi|224099087|ref|XP_002311369.1| predicted protein [Populus trichocarpa] gi|222851189|gb|EEE88736.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115452673|ref|NP_001049937.1| Os03g0315400 [Oryza sativa Japonica Group] gi|108707822|gb|ABF95617.1| Myb-like DNA-binding domain containing protein, expressed [Oryza sativa Japonica Group] gi|113548408|dbj|BAF11851.1| Os03g0315400 [Oryza sativa Japonica Group] gi|215767838|dbj|BAH00067.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125543626|gb|EAY89765.1| hypothetical protein OsI_11306 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|242035927|ref|XP_002465358.1| hypothetical protein SORBIDRAFT_01g037110 [Sorghum bicolor] gi|241919212|gb|EER92356.1| hypothetical protein SORBIDRAFT_01g037110 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|222624813|gb|EEE58945.1| hypothetical protein OsJ_10621 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|226508924|ref|NP_001141891.1| putative MYB DNA-binding domain superfamily protein [Zea mays] gi|194706320|gb|ACF87244.1| unknown [Zea mays] gi|414866528|tpg|DAA45085.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea mays] Back     alignment and taxonomy information
>gi|115474203|ref|NP_001060700.1| Os07g0688200 [Oryza sativa Japonica Group] gi|113612236|dbj|BAF22614.1| Os07g0688200 [Oryza sativa Japonica Group] gi|215737161|dbj|BAG96090.1| unnamed protein product [Oryza sativa Japonica Group] gi|323388857|gb|ADX60233.1| MYB transcription factor [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|24059885|dbj|BAC21351.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica Group] gi|50509163|dbj|BAD30303.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica Group] gi|125559670|gb|EAZ05206.1| hypothetical protein OsI_27405 [Oryza sativa Indica Group] gi|125601579|gb|EAZ41155.1| hypothetical protein OsJ_25652 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
TAIR|locus:2084269 323 MYB108 "myb domain protein 108 0.780 0.461 0.743 1.4e-62
TAIR|locus:2202633243 MYB112 "myb domain protein 112 0.769 0.604 0.735 6.2e-62
TAIR|locus:2065226273 MYB2 "AT2G47190" [Arabidopsis 0.774 0.542 0.736 1.3e-59
TAIR|locus:2199357286 MYB62 "myb domain protein 62" 0.738 0.493 0.720 2.9e-55
TAIR|locus:2032975283 MYB116 "myb domain protein 116 0.696 0.469 0.699 4.4e-52
TAIR|locus:2089159226 MYB21 "myb domain protein 21" 0.638 0.539 0.712 1.6e-47
TAIR|locus:2170573214 MYB24 "myb domain protein 24" 0.544 0.485 0.778 3.4e-45
TAIR|locus:2084168206 MYB57 "myb domain protein 57" 0.591 0.548 0.704 3.9e-44
TAIR|locus:2089812276 MYB121 "myb domain protein 121 0.602 0.416 0.675 1.1e-41
TAIR|locus:2087183269 MYB305 "myb domain protein 305 0.560 0.397 0.710 4.6e-41
TAIR|locus:2084269 MYB108 "myb domain protein 108" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 639 (230.0 bits), Expect = 1.4e-62, P = 1.4e-62
 Identities = 113/152 (74%), Positives = 134/152 (88%)

Query:     7 GFSSGNHRQQSEEAILGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCR 66
             G S  N+  + E   + +++GPWT EED  LMNY+A +GEGRWN+++  AGL RTGKSCR
Sbjct:     5 GRSLKNNNMEDE---MDLKRGPWTAEEDFKLMNYIATNGEGRWNSLSRCAGLQRTGKSCR 61

Query:    67 LRWLNYLRPDVRRGNITLQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQK 126
             LRWLNYLRPDVRRGNITL+EQL+ILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQK
Sbjct:    62 LRWLNYLRPDVRRGNITLEEQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQK 121

Query:   127 HAKQLKCDVNSKQFRDAMRFVWVPRLIERIQA 158
             HAKQLKCDVNS+QF+D M+++W+PRL+ERIQ+
Sbjct:   122 HAKQLKCDVNSQQFKDTMKYLWMPRLVERIQS 153
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0009620 "response to fungus" evidence=IMP
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP;RCA
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP;RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009733 "response to auxin stimulus" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010583 "response to cyclopentenone" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0052542 "defense response by callose deposition" evidence=RCA
TAIR|locus:2202633 MYB112 "myb domain protein 112" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065226 MYB2 "AT2G47190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199357 MYB62 "myb domain protein 62" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032975 MYB116 "myb domain protein 116" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089159 MYB21 "myb domain protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170573 MYB24 "myb domain protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084168 MYB57 "myb domain protein 57" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089812 MYB121 "myb domain protein 121" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087183 MYB305 "myb domain protein 305" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
OsI_11306
Os03g0315400 (327 aa)
(Oryza sativa Indica)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 6e-44
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 9e-42
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-15
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 5e-13
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 1e-12
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 6e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 3e-11
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-09
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 6e-09
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 1e-04
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 0.002
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  145 bits (368), Expect = 6e-44
 Identities = 75/167 (44%), Positives = 100/167 (59%), Gaps = 12/167 (7%)

Query: 22  LGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGN 81
           +G+++GPWTVEED +L++++   GEGRW ++   AGL R GKSCRLRW+NYLRP V+RG 
Sbjct: 21  MGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGG 80

Query: 82  ITLQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQFR 141
           IT  E+ +IL LH   GNRWS IA  +PGRTDNEIKNYW T ++K   +   D  + +  
Sbjct: 81  ITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQTHKPL 140

Query: 142 DAMRFVWVPRLIERIQAQSDSNSSGQ--PTSSTTTCTDNSTTTNHAD 186
           DA            I    +  S GQ  P    ++   + TT N  D
Sbjct: 141 DA----------NNIHKPEEEVSGGQKYPIEPISSSHTDDTTVNGGD 177

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
PLN03091 459 hypothetical protein; Provisional 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.86
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.85
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.76
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.68
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.68
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.56
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.56
PLN03212 249 Transcription repressor MYB5; Provisional 99.55
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.54
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.52
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.49
PLN03091 459 hypothetical protein; Provisional 99.41
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.38
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.28
KOG0051 607 consensus RNA polymerase I termination factor, Myb 99.27
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.26
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.14
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.59
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.32
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.25
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.1
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.06
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.03
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.77
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.61
KOG1279 506 consensus Chromatin remodeling factor subunit and 97.57
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.53
KOG1279506 consensus Chromatin remodeling factor subunit and 97.5
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.48
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.47
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.26
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 97.11
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.06
PRK13923170 putative spore coat protein regulator protein YlbO 96.91
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.9
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.78
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.72
PLN031421033 Probable chromatin-remodeling complex ATPase chain 96.59
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.52
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.19
PRK13923170 putative spore coat protein regulator protein YlbO 95.89
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 95.1
KOG4282 345 consensus Transcription factor GT-2 and related pr 94.84
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 94.12
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 94.05
KOG2656 445 consensus DNA methyltransferase 1-associated prote 93.76
KOG1194 534 consensus Predicted DNA-binding protein, contains 93.28
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 91.65
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 91.64
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 90.99
KOG4167 907 consensus Predicted DNA-binding protein, contains 90.9
smart0059589 MADF subfamily of SANT domain. 90.64
KOG4167 907 consensus Predicted DNA-binding protein, contains 89.96
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 86.51
KOG4282 345 consensus Transcription factor GT-2 and related pr 86.27
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 83.13
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 82.12
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 81.2
KOG4468 782 consensus Polycomb-group transcriptional regulator 80.26
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 80.13
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-37  Score=256.43  Aligned_cols=113  Identities=49%  Similarity=0.834  Sum_probs=108.3

Q ss_pred             hcCCCCCCCCHHHHHHHHHHHHHhCCCChhhhhhhcCCCCCchhhhhhhhhccCCCCcCCCCCHHHHHHHHHHHHhcCCC
Q 043269           21 ILGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGNITLQEQLMILELHSRWGNR  100 (191)
Q Consensus        21 ~~~~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~~R~~~qc~~rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~G~~  100 (191)
                      ++.+.||+||+|||++|+++|.+||.++|..||+.+|++|++++||.||.|||+|++++|.||+|||.+|++++..||++
T Consensus         4 k~~~~kGpWt~EED~~L~~~V~~~G~~~W~~i~k~~gl~R~GKSCRlRW~NyLrP~ikrg~fT~eEe~~Ii~lH~~~GNr   83 (238)
T KOG0048|consen    4 NPELVKGPWTQEEDLTQIRSIKSFGKHNGTALPKLAGLRRCGKSCRLRWTNYLRPDLKRGNFSDEEEDLIIKLHALLGNR   83 (238)
T ss_pred             CccccCCCCChHHHHHHHHHHHHhCCCCcchhhhhcCCCccchHHHHHhhcccCCCccCCCCCHHHHHHHHHHHHHHCcH
Confidence            34566899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhCCCCCHHHHHHHHHHHhHHHHhhcCC
Q 043269          101 WSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKC  133 (191)
Q Consensus       101 W~~Ia~~l~gRt~~~~k~rw~~~l~k~~~~~~~  133 (191)
                      |+.||++|||||+++|||+|+..+++++.+...
T Consensus        84 Ws~IA~~LPGRTDNeIKN~Wnt~lkkkl~~~~~  116 (238)
T KOG0048|consen   84 WSLIAGRLPGRTDNEVKNHWNTHLKKKLLKMGI  116 (238)
T ss_pred             HHHHHhhCCCcCHHHHHHHHHHHHHHHHHHcCC
Confidence            999999999999999999999999999888763

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 4e-21
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 5e-21
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 5e-21
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 6e-21
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 1e-20
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 3e-16
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 3e-14
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 2e-10
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 9e-08
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 1e-07
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 6e-07
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 1e-06
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 1e-06
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure 
Iteration: 1

 Score = 97.8 bits (242), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 68/101 (67%), Gaps = 1/101 (0%)
Query: 26  KGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGNITLQ 85
           KGPWT EED  ++ +V  +G  RW+ +A      R GK CR RW N+L P+V++ + T +
Sbjct: 27  KGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLK-GRIGKQCRERWHNHLNPEVKKTSWTEE 85
Query: 86  EQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQK 126
           E  +I + H R GNRW++IA+ LPGRTDN +KN+W + +++
Sbjct: 86  EDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRR 126
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 6e-56
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 5e-55
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 9e-55
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 1e-53
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 4e-50
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-48
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 5e-29
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 7e-07
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 3e-25
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-23
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 2e-21
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 6e-18
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 1e-14
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 3e-14
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 9e-13
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 1e-12
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-11
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-10
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 2e-09
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 6e-09
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 7e-09
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 2e-08
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 2e-07
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 2e-06
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 3e-06
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 1e-05
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 8e-04
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-05
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 3e-05
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 9e-05
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 8e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score =  172 bits (437), Expect = 6e-56
 Identities = 45/131 (34%), Positives = 65/131 (49%), Gaps = 3/131 (2%)

Query: 26  KGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRGNITLQ 85
           KGP+T  ED L+  YV  +G   W  + S    NR+ K CR RW N+L P V +   T +
Sbjct: 2   KGPFTEAEDDLIREYVKENGPQNWPRITSFLP-NRSPKQCRERWFNHLDPAVVKHAWTPE 60

Query: 86  EQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQFRDAMR 145
           E   I   + + G++WS IA+ +PGRTDN IKN W + + K                + +
Sbjct: 61  EDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLPDRSKK 120

Query: 146 FVW--VPRLIE 154
                VP+ +E
Sbjct: 121 RKAADVPKKLE 131
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.91
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.89
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.84
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.81
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.8
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.79
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.79
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.78
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.77
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.77
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.77
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.76
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.75
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.75
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.74
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.73
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.73
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.72
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.72
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.71
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.7
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.7
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.68
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.67
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.67
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.67
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.66
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.66
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.65
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.64
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.64
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.63
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.43
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.6
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.58
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.58
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.58
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.55
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.53
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.52
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.5
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.49
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.48
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.21
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.47
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.46
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.45
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.43
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.39
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.24
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.2
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.16
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.07
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.07
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.04
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.03
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.88
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.87
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.81
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.76
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.74
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.68
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.67
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.49
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.46
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.4
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.38
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.35
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.32
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.29
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.57
2crg_A70 Metastasis associated protein MTA3; transcription 98.11
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.1
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.97
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.94
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.94
2crg_A70 Metastasis associated protein MTA3; transcription 97.91
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.71
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.55
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 97.51
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.49
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.42
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.1
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.45
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 96.22
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 95.56
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 94.81
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.62
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.48
1wxp_A110 THO complex subunit 1; death domain, structural ge 90.67
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 89.13
2rq5_A121 Protein jumonji; developmental protein, nucleus, r 80.76
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
Probab=100.00  E-value=1.6e-39  Score=245.23  Aligned_cols=125  Identities=37%  Similarity=0.702  Sum_probs=103.0

Q ss_pred             CCCCCCCCCCccccchHh-hhcCCCCCCCCHHHHHHHHHHHHHhCCCChhhhhhhcCCCCCchhhhhhhhhccCCCCcCC
Q 043269            2 DAHVGGFSSGNHRQQSEE-AILGVRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPDVRRG   80 (191)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~-~~~~~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~~R~~~qc~~rw~~~l~p~~~~~   80 (191)
                      +..+++|++..|+.+|.. .+|++++|+||+|||++|+++|..||.++|..||..|+ +|++.||++||.++|+|.++++
T Consensus         2 a~~~~~Rt~~qC~~Rw~~~l~p~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~   80 (128)
T 1h8a_C            2 EAVIKNRTDVQCQHRWQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLK-GRIGKQCRERWHNHLNPEVKKT   80 (128)
T ss_dssp             --------------------CTTCCCSCCCHHHHHHHHHHHHHTCSCCHHHHHHHSS-SCCHHHHHHHHHHTTCSSSCCS
T ss_pred             ccccCCCCHHHHHHHHHHhhCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHhc-CCcHHHHHHHHHHhcccccccc
Confidence            567899999999999985 69999999999999999999999999888999999998 9999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHhcCCCHHHHhhhCCCCCHHHHHHHHHHHhHHH
Q 043269           81 NITLQEQLMILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKH  127 (191)
Q Consensus        81 ~Wt~eEd~~L~~~v~~~G~~W~~Ia~~l~gRt~~~~k~rw~~~l~k~  127 (191)
                      +||+|||++|+++|.+||++|..||++|||||+++|++||+.++++.
T Consensus        81 ~WT~eEd~~L~~~~~~~G~~W~~Ia~~l~gRt~~~~k~r~~~~~~~~  127 (128)
T 1h8a_C           81 SWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRK  127 (128)
T ss_dssp             CCCHHHHHHHHHHHHHHCSCHHHHGGGSTTCCHHHHHHHHHTTTTC-
T ss_pred             cCCHHHHHHHHHHHHHHCcCHHHHHHHCCCCCHHHHHHHHHHHHhcc
Confidence            99999999999999999999999999999999999999999998764
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1wxp_A THO complex subunit 1; death domain, structural genomics, nuclear matrix, riken structural genomics/proteomics initiative, RSGI, transport protein; NMR {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2rq5_A Protein jumonji; developmental protein, nucleus, repressor, transcription, transcription regulation; NMR {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-19
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-07
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 9e-19
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-06
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 5e-18
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 5e-15
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 9e-15
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 9e-09
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 4e-14
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 3e-04
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-11
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-08
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 5e-11
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-10
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 2e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-08
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 8e-10
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 4e-06
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-09
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 5e-06
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 5e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-06
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 4e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 5e-05
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 75.1 bits (185), Expect = 2e-19
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 24 VRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPD 76
          + KGPWT EED  L+  V  +G  RW+ +A      R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.82
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.82
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.78
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.78
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.76
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.71
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.7
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.67
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.67
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.63
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.63
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.62
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.62
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.58
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.58
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.5
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.5
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.49
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.45
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.45
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.44
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.38
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.35
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.3
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.22
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.22
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.04
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.54
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.48
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.34
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.31
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.81
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.6
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.55
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.45
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.24
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.13
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.04
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.88
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 94.82
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 94.79
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 91.07
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 86.27
d1kkxa_102 Transcription regulator Adr6 (Swi1) {Baker's yeast 81.53
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.82  E-value=2.8e-21  Score=122.11  Aligned_cols=52  Identities=46%  Similarity=0.878  Sum_probs=50.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCChhhhhhhcCCCCCchhhhhhhhhccCCC
Q 043269           24 VRKGPWTVEEDSLLMNYVAIHGEGRWNAVASSAGLNRTGKSCRLRWLNYLRPD   76 (191)
Q Consensus        24 ~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~~R~~~qc~~rw~~~l~p~   76 (191)
                      ++||+||+|||++|+++|.+||.++|..||+.|+ +|++.||++||.++|+|.
T Consensus         1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qc~~Rw~~~L~P~   52 (52)
T d1gvda_           1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE   52 (52)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHC-CCCHHHHHHHHHhhCCCC
Confidence            6899999999999999999999889999999998 999999999999999984
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kkxa_ a.4.3.1 (A:) Transcription regulator Adr6 (Swi1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure