Citrus Sinensis ID: 043272


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
QRKHTKTAANRQSIAAIRRELTATTTTNPSTIISPFFPATPAANRRPVHRKSKPTSNCHFKSIFFGQLTSYTNQLLAHAKQLFQFARNYPGLHQNSIPVIDKFYSSTRYEDELLLATAWLHRATNDQTYLNYLVSTGKTGGTRSLFAWDDKYVGAQVLAGRLVFEGQGLSGDDDNNNNNKSSTGASSRSSSTGTLLLPQYKSQAEQFICLCVQEGNNNNNLQKTPGGLLWFQPWIKLQYAATATFVVTVCSNYLTAAHASIQCSGGLVQPSDLMDLARSQADYILRKNPKEMSYTVGFGANYPTQPNHRGASIVSIKTDRIAPQWHLKGQKKGDEGNLEVGGFRMRDFLKVTSPNK
cccccccccccHHHHHHHHcccccccccccEEEcccccccHHHHccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccCEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**********RQSIAAIRRELTATTTTNPSTIISPFFPATPAANRRPVHRKSKPTSNCHFKSIFFGQLTSYTNQLLAHAKQLFQFARNYPGLHQNSIPVIDKFYSSTRYEDELLLATAWLHRATNDQTYLNYLVSTGKTGGTRSLFAWDDKYVGAQVLAGRLVFEGQGLSGDDDNNNNNKSSTGASSRSSSTGTLLLPQYKSQAEQFICLCVQEGNNNNNLQKTPGGLLWFQPWIKLQYAATATFVVTVCSNYLTAAHASIQCSGGLVQPSDLMDLARSQADYILRKNPKEMSYTVGFGANYPTQPNHRGASIVSIKTDRIAPQWHLKGQKKGDEGNLEVGGFRMRDF********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QRKHTKTAANRQSIAAIRRELTATTTTNPSTIISPFFPATPAANRRPVHRKSKPTSNCHFKSIFFGQLTSYTNQLLAHAKQLFQFARNYPGLHQNSIPVIDKFYSSTRYEDELLLATAWLHRATNDQTYLNYLVSTGKTGGTRSLFAWDDKYVGAQVLAGRLVFEGQGLSGDDDNNNNNKSSTGASSRSSSTGTLLLPQYKSQAEQFICLCVQEGNNNNNLQKTPGGLLWFQPWIKLQYAATATFVVTVCSNYLTAAHASIQCSGGLVQPSDLMDLARSQADYILRKNPKEMSYTVGFGANYPTQPNHRGASIVSIKTDRIAPQWHLKGQKKGDEGNLEVGGFRMRDFLKVTSPNK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YIK, chain A
Confidence level:very confident
Coverage over the Query: 24-168,180-181,193-256,269-353
View the alignment between query and template
View the model in PyMOL
Template: 1CLC, chain A
Confidence level:very confident
Coverage over the Query: 11-166,180-211,222-254,269-315,331-354
View the alignment between query and template
View the model in PyMOL