Citrus Sinensis ID: 043334

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900---
MMVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKGTDTENSSEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERHTHKERDCEKAKSTEMIGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKRLKE
cccccccccccccHHHHHHccccccccccccccEEEEcccccHHHHHHHHHHcccCEEcccccccccHHHHHHHHHcccccccccccccccccccccEEEEccccccccccccccccEEEECcccccccccHHHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHccccccHHHHHHHHHcccccccccccccHHHHHccccccEEEEEEccccccccHHHHHHHHHccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccccEEECccHHHHHHHHHHHccccHHHHHHHHHccccccccHHHccccccccccccccEEEEEcccccHHHHHHHHHccccEEEEEcccccHHcHHHHHHHHHHHcccccEEEEEccccccccccccccHHHHHHccccccccHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHHHHHccEEccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccEEEcccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHcccccEEEEccccccccHHHHHHcccCEEEEcccccccccccHHHHHHHHccccccEEEEcccccccccccccHHHHHHHHHHHHHcccEEEEcccccccccccccccccccccccccccccccccccEEEEcccHHHHccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcc
**VIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKG****NSSEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAE*****************IGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKRLK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKGTDTENSSEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERHTHKERDCEKAKSTEMIGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKRLKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methionine S-methyltransferase Catalyzes the S-methylmethionine (SMM) biosynthesis from adenosyl-L-homocysteine (AdoMet) and methionine. SMM biosynthesis (by MMT1) and degradation (by HMT-1, HMT-2 and HMT-3) constitute the SMM cycle in plants, which is probably required to achieve short term control of AdoMet level. Also able to catalyze the selenium-methylmethionine (SeMM) from AdoMet and selenium-methionine (SeMet). May play a role in phoem sulfur transport; such function is however not essential.confidentQ9LTB2
Methionine S-methyltransferase Catalyzes the S-methylmethionine (SMM) biosynthesis from adenosyl-L-homocysteine (AdoMet) and methionine. SMM biosynthesis (by MMT1) and degradation (by HMT-1, HMT-2 and HMT-3) constitute the SMM cycle in plants, which is probably required to achieve short term control of AdoMet level. Also able to catalyze the selenium-methylmethionine (SeMM) from AdoMet and selenium-methionine (SeMet). May play a role in phoem sulfur transport; such function is however not essential.probableQ9SWR3
Methionine S-methyltransferase Catalyzes the S-methylmethionine (SMM) biosynthesis from adenosyl-L-homocysteine (AdoMet) and methionine. SMM biosynthesis (by MMT1) and degradation (by HMT-1, HMT-2 and HMT-3) constitute the SMM cycle in plants, which is probably required to achieve short term control of AdoMet level. Also able to catalyze the selenium-methylmethionine (SeMM) from AdoMet and selenium-methionine (SeMet). May play a role in phoem sulfur transport; such function is however not essential.probableQ9MBC2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.12Methionine S-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J32, chain A
Confidence level:very confident
Coverage over the Query: 588-902
View the alignment between query and template
View the model in PyMOL
Template: 1NV8, chain A
Confidence level:very confident
Coverage over the Query: 2-80,96-206
View the alignment between query and template
View the model in PyMOL
Template: 3LPM, chain A
Confidence level:confident
Coverage over the Query: 30-79,95-124,167-242,268-296
View the alignment between query and template
View the model in PyMOL
Template: 3S1S, chain A
Confidence level:confident
Coverage over the Query: 29-80,92-306
View the alignment between query and template
View the model in PyMOL
Template: 3D2L, chain A
Confidence level:confident
Coverage over the Query: 30-78,96-135,165-251,268-326
View the alignment between query and template
View the model in PyMOL