Citrus Sinensis ID: 043334

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900---
MMVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKGTDTENSSEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERHTHKERDCEKAKSTEMIGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKRLKE
cccccccccccccHHHHHHHcccccccccccccEEEEcccccHHHHHHHHHHcccEEEcccccccccHHHHHHHHHcccccccccccccccccccccEEEEccccccccccccccccEEEEEcccccccccHHHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHccccccHHHHHHHHHcccccccccccccHHHHHccccccEEEEEEcccccccHHHHHHHHHHccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccccEEEEccHHHHHHHHHHHccccHHHHHHHHHccccccccHHHccccccccccccccEEEEEcccccHHHHHHHHHccccEEEEEcccccHHcHHHHHHHHHHHcccccEEEEEcccccccccccccHHHHHHHccccccccHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHHHHHccEEccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEcccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHcccEEEEEcccccccccccHHHHHHHHccccccEEEEcccccccccccccHHHHHHHHHHHHHcccEEEEcccccccccccccccccccccccccccccccccccEEEEcccHHHHccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcc
ccccccEEccccHHHHHHHcccccccHHccccEEEEEcccccHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHccccccccEEcccccccEcEEEEcHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHcccccEEEEEEEEEccccHHHHHHHHHHHHcccHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccccEEEcccHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHccccccccccEEEEEEccccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHHHcccEEEEEcHHHEcccccccccHHHHHHccccccccEEEEEHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHcccccHHHHHHHHHHHcccccccccEEEEcccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHccccEEEEEccccccccccHHHHHHHHccccccEEEEEcccccccccEccHHHHHHHHHHHHHcccEEEEEHHHHHEEEcccccccccHHHHHHHHcccccccccEEEEccHHHHHHHcccEEEEEEcccHHHHHHHHHcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mmvipsifipedwsftfyeglnrhpdsilkdktvaelgcgngWITIAIAEkwlpskvygldinpraIRISWINLYLNaldekgqpiydAEKKTLLDRVEFHESDLLAYCRDHDIQLERivgcipqilnpnpdaMSKIITENASEEFLYSLSNYCAlqgfvedqfGLGLIARAVEEgigvikpsgimifnmggrpgqgVCKRLFerrgfrvdKLWQTKIlqasepffasdtdISALVEIEKNSPHRFEFFmglsgdlpicARTAWAYGKAGGRISHALSVYscqlhqpnQVKKIFKFLKNGfheisssldlsfeddsvadekIPFLAYLASVLKersffpyeppagskRFRNLIADFMKKyhhiplnadnvvvfPSRAVAIENALRLFSPRLAIVDERLtrhlpkhwltsltikgtdtensseheltvieaprqsDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFldisdhfelsslpssngvlkylagnvlpsHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAErhthkerdcekakstemigfSRSAISVLNsaelsitetpnsglihmdvdqsflpipsLVKAAIFESFArqnmseseidvtPSIQQYIKsnfgfpidinaefiYADCSQSLFNKLVLCCILeggtlcfpagsngnyVSAARFLKAnivniptesevgfkMTEKTLVTILETvkkpwvyisgptinptgllysnkEIENILTVCAKYGARVVIDTAFsglefnyegwggwdlegclsklysstnssfnvSLLGGLSLKMLTGALKFGFLVLnhpqlvdafssfpglskphsTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKRLKE
mmvipsifipedWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKilqasepffaSDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSffpyeppagSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLtrhlpkhwltsltikgtdtensseheltvieaprqsDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERHTHKERDCEKakstemigfsrsAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNiptesevgfkmTEKTLVTILetvkkpwvyisgptinptgllysNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSsfpglskphstVRYAIKKLLGLRERKARDLMNAVAEhirnlesrskrlke
MMVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEIsssldlsfeddsVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKGTDTENSSEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERHTHKERDCEKAKSTEMIGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKRLKE
**VIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKG************VIE***QSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERH***************IGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNM***EIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLM*******************
**VIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNP***************EFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKG****NSSEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAF*****************************************TPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKRLK*
MMVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKGT********ELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAE**************TEMIGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLE********
*MVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKGTDTENSSEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAER*********KAKSTEMIGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKRLK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEKNSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKGTDTENSSEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFLDISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERHTHKERDCEKAKSTEMIGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKRLKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query903 2.2.26 [Sep-21-2011]
Q9LTB21071 Methionine S-methyltransf yes no 0.983 0.829 0.748 0.0
Q9SWR31088 Methionine S-methyltransf N/A no 0.990 0.821 0.731 0.0
Q9MBC2 1088 Methionine S-methyltransf N/A no 0.986 0.818 0.697 0.0
Q8W519 1091 Methionine S-methyltransf N/A no 0.990 0.819 0.682 0.0
Q845V2364 Histidinol-phosphate amin yes no 0.203 0.505 0.244 1e-07
Q39K90357 Histidinol-phosphate amin yes no 0.203 0.515 0.234 1e-06
B3ECG2355 Histidinol-phosphate amin yes no 0.202 0.515 0.248 2e-05
Q3JMZ7356 Histidinol-phosphate amin yes no 0.194 0.494 0.210 3e-05
Q63Q87356 Histidinol-phosphate amin yes no 0.194 0.494 0.205 6e-05
Q62GE0356 Histidinol-phosphate amin yes no 0.194 0.494 0.205 6e-05
>sp|Q9LTB2|MMT1_ARATH Methionine S-methyltransferase OS=Arabidopsis thaliana GN=MMT1 PE=2 SV=1 Back     alignment and function desciption
 Score = 1401 bits (3627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/903 (74%), Positives = 788/903 (87%), Gaps = 15/903 (1%)

Query: 1   MMVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGL 60
           MMVIPSIFIPEDWSFTFYEGLNRHPD+I KDKTV+ELGCGNGWI+IAIA KWLPSKVYGL
Sbjct: 85  MMVIPSIFIPEDWSFTFYEGLNRHPDTIFKDKTVSELGCGNGWISIAIAAKWLPSKVYGL 144

Query: 61  DINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIV 120
           DINPRA++ISWINLYLNALD+ G+P+YD EKKTLLDRVEF+ESDLL YCRD+ IQLERIV
Sbjct: 145 DINPRAVKISWINLYLNALDDNGEPVYDEEKKTLLDRVEFYESDLLGYCRDNKIQLERIV 204

Query: 121 GCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVI 180
           GCIPQILNPNP+AMSK+ITENASEEFL+SLSNYCALQGFVEDQFGLGLIARAVEEGI VI
Sbjct: 205 GCIPQILNPNPEAMSKLITENASEEFLHSLSNYCALQGFVEDQFGLGLIARAVEEGISVI 264

Query: 181 KPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEK 240
           KP+GIMIFNMGGRPGQGVC+RLFERRG RV ++WQTKILQA+      DTDISALVEIE+
Sbjct: 265 KPAGIMIFNMGGRPGQGVCRRLFERRGVRVTQMWQTKILQAA------DTDISALVEIER 318

Query: 241 NSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNG 300
           +SPHRFEFFMGLSGD PICARTAWAYGKAGGRISHALSVYSCQ+ QPN VK IF FLKNG
Sbjct: 319 SSPHRFEFFMGLSGDQPICARTAWAYGKAGGRISHALSVYSCQIRQPNLVKIIFDFLKNG 378

Query: 301 FHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKY 360
           F EIS+SLDLSFED++VADEKIPFLAYLASVLK  S+FP+EPPAGSKRF +LIA FM+ Y
Sbjct: 379 FQEISNSLDLSFEDETVADEKIPFLAYLASVLKNSSYFPFEPPAGSKRFCSLIAGFMRTY 438

Query: 361 HHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKGTDTENS 420
           H IP+N DN+VVFPSRAVAIE+A RLFSPRLAIVDE LTR LP+ WLTSL I+ T  + S
Sbjct: 439 HRIPINQDNIVVFPSRAVAIESAFRLFSPRLAIVDEHLTRQLPRSWLTSLAIEDTSMDKS 498

Query: 421 SEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFL 480
            + ++TVIE+P QSDLM+ELIKKLKPQVV++G+  FE +TSS+F+HLL+VT+E+G RLFL
Sbjct: 499 DD-QITVIESPHQSDLMIELIKKLKPQVVVTGMAPFEVITSSSFLHLLEVTKEIGCRLFL 557

Query: 481 DISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKA 540
           DISDHFELSSLP+SNGVLKYLA N LPSHAA+ICGLVKN+VYSDLEVAF+I+E +AI KA
Sbjct: 558 DISDHFELSSLPASNGVLKYLAENQLPSHAAIICGLVKNKVYSDLEVAFVITEVDAIAKA 617

Query: 541 LSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERHTHKERDCEKAKSTEMIGFSRSAIS 600
           LSKTVEVLEG TA+ISQ YYGCLFHELLAFQLA+RH   ER+ EKAKS E+IGFS SA+S
Sbjct: 618 LSKTVEVLEGHTAIISQYYYGCLFHELLAFQLADRHAPAERESEKAKSEEIIGFSSSAVS 677

Query: 601 VLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQY 660
           +L  AELS+TE   + LIHMDVDQSFL IP  VKAAIFESF RQN+SE+E+D+ PSI+Q+
Sbjct: 678 ILKDAELSVTEIDETSLIHMDVDQSFLQIPQSVKAAIFESFVRQNISEAEVDINPSIKQF 737

Query: 661 IKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANI 720
           + SN+GFP   +  F+YAD S +LFNKLV+CC  EGGTLC PAG+NGNYV+AA+FLKAN+
Sbjct: 738 VWSNYGFPTKSSTGFVYADGSLALFNKLVICCAQEGGTLCLPAGTNGNYVAAAKFLKANV 797

Query: 721 VNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYG 780
           VNIPTES  GFK+TEKTL   LE+VKKPWV ISGPT++PTGL+YSN+E++ +L+ CAK+G
Sbjct: 798 VNIPTESSDGFKLTEKTLTKALESVKKPWVCISGPTVSPTGLVYSNEEMDILLSTCAKFG 857

Query: 781 ARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGF 840
           A+V+IDT+FSGLE++      WDL+  LSK+    +SS +VSLLG LSL +L+GA+K GF
Sbjct: 858 AKVIIDTSFSGLEYSAT---SWDLKNALSKM----DSSLSVSLLGCLSLNLLSGAIKLGF 910

Query: 841 LVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKR 900
           LVL+   L+DAF + PGLSKPHSTV+YA KK+L L+E KA D ++AV+E I+ LE RS+R
Sbjct: 911 LVLDQ-SLIDAFHTLPGLSKPHSTVKYAAKKMLALKEEKASDFLDAVSETIKTLEGRSRR 969

Query: 901 LKE 903
           LKE
Sbjct: 970 LKE 972
Catalyzes the S-methylmethionine (SMM) biosynthesis from adenosyl-L-homocysteine (AdoMet) and methionine. SMM biosynthesis (by MMT1) and degradation (by HMT-1, HMT-2 and HMT-3) constitute the SMM cycle in plants, which is probably required to achieve short term control of AdoMet level. Also able to catalyze the selenium-methylmethionine (SeMM) from AdoMet and selenium-methionine (SeMet). May play a role in phoem sulfur transport; such function is however not essential.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q9SWR3|MMT1_WOLBI Methionine S-methyltransferase OS=Wollastonia biflora GN=MMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9MBC2|MMT1_HORVU Methionine S-methyltransferase OS=Hordeum vulgare GN=MMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8W519|MMT1_MAIZE Methionine S-methyltransferase OS=Zea mays GN=MMT1 PE=2 SV=2 Back     alignment and function description
>sp|Q845V2|HIS8_BURM1 Histidinol-phosphate aminotransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisC PE=3 SV=1 Back     alignment and function description
>sp|Q39K90|HIS81_BURS3 Histidinol-phosphate aminotransferase 1 OS=Burkholderia sp. (strain 383) GN=hisC1 PE=3 SV=1 Back     alignment and function description
>sp|B3ECG2|HIS8_CHLL2 Histidinol-phosphate aminotransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisC PE=3 SV=1 Back     alignment and function description
>sp|Q3JMZ7|HIS82_BURP1 Histidinol-phosphate aminotransferase 2 OS=Burkholderia pseudomallei (strain 1710b) GN=hisC2 PE=3 SV=1 Back     alignment and function description
>sp|Q63Q87|HIS82_BURPS Histidinol-phosphate aminotransferase 2 OS=Burkholderia pseudomallei (strain K96243) GN=hisC2 PE=3 SV=1 Back     alignment and function description
>sp|Q62GE0|HIS81_BURMA Histidinol-phosphate aminotransferase 1 OS=Burkholderia mallei (strain ATCC 23344) GN=hisC1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query903
225465288 1092 PREDICTED: methionine S-methyltransferas 0.993 0.821 0.817 0.0
297739444 1089 unnamed protein product [Vitis vinifera] 0.990 0.820 0.816 0.0
2555698061001 Methionine S-methyltransferase, putative 0.991 0.894 0.810 0.0
449431900 1084 PREDICTED: methionine S-methyltransferas 0.991 0.825 0.796 0.0
224129814 1095 methionine s-methyltransferase [Populus 0.998 0.823 0.799 0.0
92893696 1098 SAM (and some other nucleotide) binding 1.0 0.822 0.790 0.0
449478096 1084 PREDICTED: methionine S-methyltransferas 0.991 0.825 0.794 0.0
357445181 1092 Methionine S-methyltransferase [Medicago 0.993 0.821 0.789 0.0
356541838 1090 PREDICTED: methionine S-methyltransferas 0.993 0.822 0.781 0.0
356559151 1091 PREDICTED: methionine S-methyltransferas 0.993 0.822 0.778 0.0
>gi|225465288|ref|XP_002270977.1| PREDICTED: methionine S-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1540 bits (3987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/903 (81%), Positives = 812/903 (89%), Gaps = 6/903 (0%)

Query: 1   MMVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGL 60
           MMVIPSIFIPEDWSFTFYEGLNRHPDSI KDKTVAELGCGNGWI+IAIAEKW P KVYGL
Sbjct: 89  MMVIPSIFIPEDWSFTFYEGLNRHPDSIFKDKTVAELGCGNGWISIAIAEKWSPLKVYGL 148

Query: 61  DINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIV 120
           DINPRA++ISWINLYLNALD+ GQPIYD E KTLLDRVEFHESDLLAYCRD  I+LERIV
Sbjct: 149 DINPRAVKISWINLYLNALDDNGQPIYDGENKTLLDRVEFHESDLLAYCRDRGIELERIV 208

Query: 121 GCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVI 180
           GCIPQILNPNPDAMSK+ITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGI VI
Sbjct: 209 GCIPQILNPNPDAMSKMITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIAVI 268

Query: 181 KPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEK 240
           KP GIMIFNMGGRPGQGVCKRLFERRGFRV +LWQTK++QA+      DTDISALVEIEK
Sbjct: 269 KPMGIMIFNMGGRPGQGVCKRLFERRGFRVTRLWQTKVIQAA------DTDISALVEIEK 322

Query: 241 NSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNG 300
           NSPHRFEFFMGL+GD PICARTAWAYGKAGGRISHALSVYSCQL QPNQVK IF+FLKNG
Sbjct: 323 NSPHRFEFFMGLAGDQPICARTAWAYGKAGGRISHALSVYSCQLRQPNQVKTIFEFLKNG 382

Query: 301 FHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKY 360
           FHEISSSLDL FEDDSVADEKIPFLAYLASVLK  SFFPYEPPAGSKRFRNLIA FM+ Y
Sbjct: 383 FHEISSSLDLFFEDDSVADEKIPFLAYLASVLKGNSFFPYEPPAGSKRFRNLIAGFMRTY 442

Query: 361 HHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKGTDTENS 420
           HH+P+NADNVV+FPSRAVAIENALRLFSPRLAIVDE LTRHLP+ WLTSL I+   T+N 
Sbjct: 443 HHVPVNADNVVIFPSRAVAIENALRLFSPRLAIVDEDLTRHLPRQWLTSLKIESAKTDNP 502

Query: 421 SEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFL 480
           SE  LTVIEAPRQSDLM+ELIKKLKPQVV++GI  FEAVTSSAF HLL++T ++GSRLFL
Sbjct: 503 SEDVLTVIEAPRQSDLMIELIKKLKPQVVVTGIAHFEAVTSSAFEHLLNITGKIGSRLFL 562

Query: 481 DISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKA 540
           D+SDHFELSSLPSSNGVLKYL+G  LPSHAAVICGLVKNQVYSDLEVAF+ISEEEAIFKA
Sbjct: 563 DMSDHFELSSLPSSNGVLKYLSGTPLPSHAAVICGLVKNQVYSDLEVAFVISEEEAIFKA 622

Query: 541 LSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERHTHKERDCEKAKSTEMIGFSRSAIS 600
           LSKTVE+LEG TALISQ YYGCLF ELLAFQLA+RH   ER CE  K  EMIGF+ SA+S
Sbjct: 623 LSKTVELLEGNTALISQYYYGCLFRELLAFQLADRHPPAERVCENEKPAEMIGFASSALS 682

Query: 601 VLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQY 660
           VL++AELSITET NS +IHMDVD+SFLP PS VKA+IFESF+RQNM+ESE D+T SI+Q+
Sbjct: 683 VLDNAELSITETENSSVIHMDVDKSFLPFPSSVKASIFESFSRQNMAESETDITTSIRQF 742

Query: 661 IKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANI 720
           IKSN+GFP     EFIYADCS +LFNKLVLCCI EGGTLCFPAGSNGN+VS+A+FLKANI
Sbjct: 743 IKSNYGFPTSSGTEFIYADCSLALFNKLVLCCIQEGGTLCFPAGSNGNHVSSAKFLKANI 802

Query: 721 VNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYG 780
           VNIPT SE GFK++EKTL  + E+V  PW+YISGPTINPTGL+YSN E+ENIL++CAK+G
Sbjct: 803 VNIPTNSEFGFKLSEKTLAGVFESVNNPWLYISGPTINPTGLVYSNGEMENILSICAKFG 862

Query: 781 ARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGF 840
           A+VV+DT+FSGLE+++EG GGWDLEG L +LYSS+  SF VSLLGGLSLKMLTG L  GF
Sbjct: 863 AKVVLDTSFSGLEYDFEGCGGWDLEGILVRLYSSSKPSFCVSLLGGLSLKMLTGGLTCGF 922

Query: 841 LVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKR 900
           LVLN P L+DAF SFPGLSKPHSTV+Y +KKLLGLRE+KA  L++AVAEH R L SR+KR
Sbjct: 923 LVLNQPLLIDAFYSFPGLSKPHSTVKYTVKKLLGLREQKAGGLLDAVAEHKRILCSRAKR 982

Query: 901 LKE 903
           LK+
Sbjct: 983 LKQ 985

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297739444|emb|CBI29626.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255569806|ref|XP_002525867.1| Methionine S-methyltransferase, putative [Ricinus communis] gi|223534872|gb|EEF36561.1| Methionine S-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449431900|ref|XP_004133738.1| PREDICTED: methionine S-methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224129814|ref|XP_002328809.1| methionine s-methyltransferase [Populus trichocarpa] gi|222839107|gb|EEE77458.1| methionine s-methyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|92893696|gb|ABE91874.1| SAM (and some other nucleotide) binding motif [Medicago truncatula] Back     alignment and taxonomy information
>gi|449478096|ref|XP_004155222.1| PREDICTED: methionine S-methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357445181|ref|XP_003592868.1| Methionine S-methyltransferase [Medicago truncatula] gi|355481916|gb|AES63119.1| Methionine S-methyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356541838|ref|XP_003539379.1| PREDICTED: methionine S-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|356559151|ref|XP_003547864.1| PREDICTED: methionine S-methyltransferase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query903
TAIR|locus:21554661071 MMT "methionine S-methyltransf 0.983 0.829 0.738 0.0
UNIPROTKB|Q81MM2387 BAS3918 "Aminotransferase, cla 0.191 0.447 0.277 1.6e-05
TIGR_CMR|BA_4225387 BA_4225 "aminotransferase, cla 0.191 0.447 0.277 1.6e-05
TAIR|locus:2155466 MMT "methionine S-methyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3480 (1230.1 bits), Expect = 0., P = 0.
 Identities = 667/903 (73%), Positives = 776/903 (85%)

Query:     1 MMVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGL 60
             MMVIPSIFIPEDWSFTFYEGLNRHPD+I KDKTV+ELGCGNGWI+IAIA KWLPSKVYGL
Sbjct:    85 MMVIPSIFIPEDWSFTFYEGLNRHPDTIFKDKTVSELGCGNGWISIAIAAKWLPSKVYGL 144

Query:    61 DINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIV 120
             DINPRA++ISWINLYLNALD+ G+P+YD EKKTLLDRVEF+ESDLL YCRD+ IQLERIV
Sbjct:   145 DINPRAVKISWINLYLNALDDNGEPVYDEEKKTLLDRVEFYESDLLGYCRDNKIQLERIV 204

Query:   121 GCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVI 180
             GCIPQILNPNP+AMSK+ITENASEEFL+SLSNYCALQGFVEDQFGLGLIARAVEEGI VI
Sbjct:   205 GCIPQILNPNPEAMSKLITENASEEFLHSLSNYCALQGFVEDQFGLGLIARAVEEGISVI 264

Query:   181 KPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEK 240
             KP+GIMIFNMGGRPGQGVC+RLFERRG RV ++WQTKILQA+      DTDISALVEIE+
Sbjct:   265 KPAGIMIFNMGGRPGQGVCRRLFERRGVRVTQMWQTKILQAA------DTDISALVEIER 318

Query:   241 NSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNG 300
             +SPHRFEFFMGLSGD PICARTAWAYGKAGGRISHALSVYSCQ+ QPN VK IF FLKNG
Sbjct:   319 SSPHRFEFFMGLSGDQPICARTAWAYGKAGGRISHALSVYSCQIRQPNLVKIIFDFLKNG 378

Query:   301 FHEIXXXXXXXXXXXXVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKY 360
             F EI            VADEKIPFLAYLASVLK  S+FP+EPPAGSKRF +LIA FM+ Y
Sbjct:   379 FQEISNSLDLSFEDETVADEKIPFLAYLASVLKNSSYFPFEPPAGSKRFCSLIAGFMRTY 438

Query:   361 HHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKGTDTENS 420
             H IP+N DN+VVFPSRAVAIE+A RLFSPRLAIVDE LTR LP+ WLTSL I+ T  + S
Sbjct:   439 HRIPINQDNIVVFPSRAVAIESAFRLFSPRLAIVDEHLTRQLPRSWLTSLAIEDTSMDKS 498

Query:   421 SEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFL 480
              + ++TVIE+P QSDLM+ELIKKLKPQVV++G+  FE +TSS+F+HLL+VT+E+G RLFL
Sbjct:   499 DD-QITVIESPHQSDLMIELIKKLKPQVVVTGMAPFEVITSSSFLHLLEVTKEIGCRLFL 557

Query:   481 DISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKA 540
             DISDHFELSSLP+SNGVLKYLA N LPSHAA+ICGLVKN+VYSDLEVAF+I+E +AI KA
Sbjct:   558 DISDHFELSSLPASNGVLKYLAENQLPSHAAIICGLVKNKVYSDLEVAFVITEVDAIAKA 617

Query:   541 LSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERHTHKERDCEKAKSTEMIGFSRSAIS 600
             LSKTVEVLEG TA+ISQ YYGCLFHELLAFQLA+RH   ER+ EKAKS E+IGFS SA+S
Sbjct:   618 LSKTVEVLEGHTAIISQYYYGCLFHELLAFQLADRHAPAERESEKAKSEEIIGFSSSAVS 677

Query:   601 VLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQY 660
             +L  AELS+TE   + LIHMDVDQSFL IP  VKAAIFESF RQN+SE+E+D+ PSI+Q+
Sbjct:   678 ILKDAELSVTEIDETSLIHMDVDQSFLQIPQSVKAAIFESFVRQNISEAEVDINPSIKQF 737

Query:   661 IKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANI 720
             + SN+GFP   +  F+YAD S +LFNKLV+CC  EGGTLC PAG+NGNYV+AA+FLKAN+
Sbjct:   738 VWSNYGFPTKSSTGFVYADGSLALFNKLVICCAQEGGTLCLPAGTNGNYVAAAKFLKANV 797

Query:   721 VNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYG 780
             VNIPTES  GFK+TEKTL   LE+VKKPWV ISGPT++PTGL+YSN+E++ +L+ CAK+G
Sbjct:   798 VNIPTESSDGFKLTEKTLTKALESVKKPWVCISGPTVSPTGLVYSNEEMDILLSTCAKFG 857

Query:   781 ARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGF 840
             A+V+IDT+FSGLE++   W   DL+  LSK+    +SS +VSLLG LSL +L+GA+K GF
Sbjct:   858 AKVIIDTSFSGLEYSATSW---DLKNALSKM----DSSLSVSLLGCLSLNLLSGAIKLGF 910

Query:   841 LVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKR 900
             LVL+   L+DAF + PGLSKPHSTV+YA KK+L L+E KA D ++AV+E I+ LE RS+R
Sbjct:   911 LVLDQ-SLIDAFHTLPGLSKPHSTVKYAAKKMLALKEEKASDFLDAVSETIKTLEGRSRR 969

Query:   901 LKE 903
             LKE
Sbjct:   970 LKE 972
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=ISS;IMP
GO:0009058 "biosynthetic process" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0001887 "selenium compound metabolic process" evidence=IMP
GO:0046500 "S-adenosylmethionine metabolic process" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
UNIPROTKB|Q81MM2 BAS3918 "Aminotransferase, classes I and II" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4225 BA_4225 "aminotransferase, classes I and II" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9MBC2MMT1_HORVU2, ., 1, ., 1, ., 1, 20.69700.98670.8189N/Ano
Q8W519MMT1_MAIZE2, ., 1, ., 1, ., 1, 20.68250.99000.8194N/Ano
Q9SWR3MMT1_WOLBI2, ., 1, ., 1, ., 1, 20.73170.99000.8216N/Ano
Q9LTB2MMT1_ARATH2, ., 1, ., 1, ., 1, 20.74860.98330.8291yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.976
4th Layer2.1.1.120.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00035361001
SubName- Full=Chromosome undetermined scaffold_77, whole genome shotgun sequence; (1090 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00038829001
SubName- Full=Chromosome chr5 scaffold_98, whole genome shotgun sequence; (807 aa)
     •  0.899
GSVIVG00018515001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (270 aa)
     •  0.899
GSVIVG00017439001
SubName- Full=Chromosome chr6 scaffold_15, whole genome shotgun sequence; (767 aa)
     •  0.899
GSVIVG00008913001
SubName- Full=Chromosome chr14 scaffold_211, whole genome shotgun sequence; (217 aa)
     •  0.899
GSVIVG00003836001
SubName- Full=Chromosome chr8 scaffold_150, whole genome shotgun sequence; (765 aa)
     •  0.899
GSVIVG00000520001
SubName- Full=Chromosome chr2 scaffold_105, whole genome shotgun sequence; (438 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query903
PLN026721082 PLN02672, PLN02672, methionine S-methyltransferase 0.0
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 8e-10
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 4e-09
COG0436393 COG0436, COG0436, Aspartate/tyrosine/aromatic amin 2e-08
COG2890280 COG2890, HemK, Methylase of polypeptide chain rele 1e-07
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 2e-07
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 5e-07
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met 6e-07
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 8e-07
PRK09328275 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-meth 2e-06
pfam05175170 pfam05175, MTS, Methyltransferase small domain 2e-06
COG4123248 COG4123, COG4123, Predicted O-methyltransferase [G 4e-06
PRK07683387 PRK07683, PRK07683, aminotransferase A; Validated 6e-06
TIGR00406288 TIGR00406, prmA, ribosomal protein L11 methyltrans 3e-05
PRK05764393 PRK05764, PRK05764, aspartate aminotransferase; Pr 4e-05
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 5e-05
COG2813300 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Trans 5e-05
COG2264300 COG2264, PrmA, Ribosomal protein L11 methylase [Tr 2e-04
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 3e-04
PRK07309391 PRK07309, PRK07309, aromatic amino acid aminotrans 3e-04
PRK07568397 PRK07568, PRK07568, aspartate aminotransferase; Pr 5e-04
pfam06325294 pfam06325, PrmA, Ribosomal protein L11 methyltrans 5e-04
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 6e-04
TIGR00536284 TIGR00536, hemK_fam, HemK family putative methylas 6e-04
PRK06358354 PRK06358, PRK06358, threonine-phosphate decarboxyl 6e-04
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase doma 0.001
COG1167459 COG1167, ARO8, Transcriptional regulators containi 0.001
PRK00517250 PRK00517, prmA, ribosomal protein L11 methyltransf 0.001
COG2263198 COG2263, COG2263, Predicted RNA methylase [Transla 0.002
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 0.002
PRK08363398 PRK08363, PRK08363, alanine aminotransferase; Vali 0.004
>gnl|CDD|215360 PLN02672, PLN02672, methionine S-methyltransferase Back     alignment and domain information 
 Score = 1727 bits (4474), Expect = 0.0
 Identities = 695/903 (76%), Positives = 785/903 (86%), Gaps = 7/903 (0%)

Query: 1   MMVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGL 60
           MM IPSIFIPEDWSFTFYEGLNRHPDSI +DKTVAELGCGNGWI+IAIAEKWLPSKVYGL
Sbjct: 89  MMEIPSIFIPEDWSFTFYEGLNRHPDSIFRDKTVAELGCGNGWISIAIAEKWLPSKVYGL 148

Query: 61  DINPRAIRISWINLYLNALDEKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIV 120
           DINPRA++++WINLYLNALD+ G P+YD E KTLLDRVEF+ESDLL YCRD++I+L+RIV
Sbjct: 149 DINPRAVKVAWINLYLNALDDDGLPVYDGEGKTLLDRVEFYESDLLGYCRDNNIELDRIV 208

Query: 121 GCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGIGVI 180
           GCIPQILNPNP+AMSK++TENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGI VI
Sbjct: 209 GCIPQILNPNPEAMSKLVTENASEEFLYSLSNYCALQGFVEDQFGLGLIARAVEEGISVI 268

Query: 181 KPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEK 240
           KP GIMIFNMGGRPGQ VC+RLFERRGFR+ KLWQTKI QA+      DTDISALVEIEK
Sbjct: 269 KPMGIMIFNMGGRPGQAVCERLFERRGFRITKLWQTKINQAA------DTDISALVEIEK 322

Query: 241 NSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNG 300
           NS HRFEFFMGL GD PICARTAWAYGKAGGRISHALSVYSCQL QPNQVK IFKFLKNG
Sbjct: 323 NSRHRFEFFMGLVGDQPICARTAWAYGKAGGRISHALSVYSCQLRQPNQVKTIFKFLKNG 382

Query: 301 FHEISSSLDLSFEDDSVADEKIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKY 360
           FHE+S SLDLSFED+SVADEKIPFLAYLAS LK  S+FP EPPAGSKRFRNLIA FM+ Y
Sbjct: 383 FHEVSGSLDLSFEDESVADEKIPFLAYLASALKGLSYFPCEPPAGSKRFRNLIAGFMRIY 442

Query: 361 HHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTRHLPKHWLTSLTIKGTDTENS 420
           HHIPL  DNVVVFPSRAVAIENALRLFSPRLAIVDE LTR LPK WLTSL I+   +++ 
Sbjct: 443 HHIPLTPDNVVVFPSRAVAIENALRLFSPRLAIVDEHLTRWLPKKWLTSLAIENATSDSK 502

Query: 421 SEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFL 480
           S+  +TVIEAPRQSDL++ELIKKLKPQVV++G+ DFE  TS+AF HLL+VT E+G+RLFL
Sbjct: 503 SDDVITVIEAPRQSDLVIELIKKLKPQVVVTGMADFEMRTSTAFEHLLNVTAEIGARLFL 562

Query: 481 DISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKA 540
           DISDH ELSSLP SNGVLKYLAG+ LPSHAA+ICGLVKNQVYSDLEVAF+ISE EA+ KA
Sbjct: 563 DISDHLELSSLPGSNGVLKYLAGHPLPSHAAIICGLVKNQVYSDLEVAFVISENEAVLKA 622

Query: 541 LSKTVEVLEGTTALISQNYYGCLFHELLAFQLAERHTHKERDCEKAKSTEMIGFSRSAIS 600
           LSKT EVLEG TA+ISQ YYGCLFHELLAFQLA+RHT +ER  E+ +S++ IGFS SA S
Sbjct: 623 LSKTGEVLEGRTAIISQFYYGCLFHELLAFQLADRHTPQERLPEEEESSKFIGFSSSARS 682

Query: 601 VLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPSIQQY 660
            L  AELS++ +  S LIHMDVD+SFLP+PS VKA+IFESF RQN+SESE D  PSI Q+
Sbjct: 683 ALKEAELSVSGSQESSLIHMDVDESFLPVPSAVKASIFESFVRQNISESETDPRPSILQF 742

Query: 661 IKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANI 720
           IKSN+GFP D   EF+Y D S +LFNKLVLCC+ EGGTLCFPAGSNG YVSAA+FLKAN 
Sbjct: 743 IKSNYGFPTDSCTEFVYGDTSLALFNKLVLCCVQEGGTLCFPAGSNGTYVSAAKFLKANF 802

Query: 721 VNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYG 780
             IPT+S  GFK+T KTL + LETVKKPWVYISGPTINPTGLLYSN EIE IL+VCAKYG
Sbjct: 803 RRIPTKSSDGFKLTAKTLASTLETVKKPWVYISGPTINPTGLLYSNSEIEEILSVCAKYG 862

Query: 781 ARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGF 840
           ARV+IDT+FSGLE++  GWGGWDL+  LS+L SS N SF V+LLGGLS ++L+G  +FGF
Sbjct: 863 ARVIIDTSFSGLEYDTSGWGGWDLKSILSRLKSS-NPSFAVALLGGLSTELLSGGHEFGF 921

Query: 841 LVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKR 900
           L LN   L+DAF S PGLS+PHST++Y IKKLLGL+ +K+ DL++ VAE  + L+SR++R
Sbjct: 922 LALNDSVLIDAFHSAPGLSRPHSTLKYTIKKLLGLKNQKSSDLLDGVAEQKKILKSRAER 981

Query: 901 LKE 903
           LKE
Sbjct: 982 LKE 984

Length = 1082
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|223513 COG0436, COG0436, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|225443 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|236467 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|203189 pfam05175, MTS, Methyltransferase small domain Back     alignment and domain information
>gnl|CDD|226608 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236075 PRK07683, PRK07683, aminotransferase A; Validated Back     alignment and domain information
>gnl|CDD|232960 TIGR00406, prmA, ribosomal protein L11 methyltransferase Back     alignment and domain information
>gnl|CDD|235596 PRK05764, PRK05764, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225370 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|225173 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|235985 PRK07309, PRK07309, aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181036 PRK07568, PRK07568, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|218990 pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|129627 TIGR00536, hemK_fam, HemK family putative methylases Back     alignment and domain information
>gnl|CDD|180542 PRK06358, PRK06358, threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|224089 COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234786 PRK00517, prmA, ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|225172 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|181402 PRK08363, PRK08363, alanine aminotransferase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 903
PLN026721082 methionine S-methyltransferase 100.0
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 100.0
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 100.0
PLN02368407 alanine transaminase 100.0
PLN00175413 aminotransferase family protein; Provisional 100.0
PRK06290410 aspartate aminotransferase; Provisional 100.0
PRK07366388 succinyldiaminopimelate transaminase; Validated 100.0
PRK09147396 succinyldiaminopimelate transaminase; Provisional 100.0
PRK07681399 aspartate aminotransferase; Provisional 100.0
PRK06348384 aspartate aminotransferase; Provisional 100.0
PTZ00377 481 alanine aminotransferase; Provisional 100.0
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 100.0
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 100.0
PRK05942394 aspartate aminotransferase; Provisional 100.0
PRK08068389 transaminase; Reviewed 100.0
PRK08636403 aspartate aminotransferase; Provisional 100.0
PRK08960387 hypothetical protein; Provisional 100.0
PRK13355517 bifunctional HTH-domain containing protein/aminotr 100.0
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 100.0
PRK09148405 aminotransferase; Validated 100.0
PLN02187 462 rooty/superroot1 100.0
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 100.0
PRK06855 433 aminotransferase; Validated 100.0
PLN02656409 tyrosine transaminase 100.0
PRK12414384 putative aminotransferase; Provisional 100.0
PRK06207405 aspartate aminotransferase; Provisional 100.0
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 100.0
PRK07682378 hypothetical protein; Validated 100.0
PRK06107402 aspartate aminotransferase; Provisional 100.0
PRK05839374 hypothetical protein; Provisional 100.0
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 100.0
PRK09082386 methionine aminotransferase; Validated 100.0
PRK07337388 aminotransferase; Validated 100.0
PLN02450 468 1-aminocyclopropane-1-carboxylate synthase 100.0
PRK07683387 aminotransferase A; Validated 100.0
PRK08912387 hypothetical protein; Provisional 100.0
PTZ00433412 tyrosine aminotransferase; Provisional 100.0
PRK09257396 aromatic amino acid aminotransferase; Provisional 100.0
PRK06108382 aspartate aminotransferase; Provisional 100.0
PRK08361391 aspartate aminotransferase; Provisional 100.0
PRK07309391 aromatic amino acid aminotransferase; Validated 100.0
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 100.0
PRK07550386 hypothetical protein; Provisional 100.0
PLN02376 496 1-aminocyclopropane-1-carboxylate synthase 100.0
PRK05957389 aspartate aminotransferase; Provisional 100.0
PRK07777387 aminotransferase; Validated 100.0
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 100.0
PTZ00376404 aspartate aminotransferase; Provisional 100.0
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 100.0
PLN02231 534 alanine transaminase 100.0
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 100.0
PRK07324373 transaminase; Validated 100.0
PRK07568397 aspartate aminotransferase; Provisional 100.0
PRK09265404 aminotransferase AlaT; Validated 100.0
PRK08363398 alanine aminotransferase; Validated 100.0
PRK08175395 aminotransferase; Validated 100.0
PRK09275 527 aspartate aminotransferase; Provisional 100.0
PRK01533366 histidinol-phosphate aminotransferase; Validated 100.0
PRK05764393 aspartate aminotransferase; Provisional 100.0
PRK02610374 histidinol-phosphate aminotransferase; Provisional 100.0
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 100.0
PRK14809357 histidinol-phosphate aminotransferase; Provisional 100.0
PRK15481431 transcriptional regulatory protein PtsJ; Provision 100.0
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 100.0
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 100.0
PRK06358354 threonine-phosphate decarboxylase; Provisional 100.0
PRK03317368 histidinol-phosphate aminotransferase; Provisional 100.0
KOG0259447 consensus Tyrosine aminotransferase [Amino acid tr 100.0
TIGR03801 521 asp_4_decarbox aspartate 4-decarboxylase. This enz 100.0
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 100.0
PLN02397423 aspartate transaminase 100.0
PRK05166371 histidinol-phosphate aminotransferase; Provisional 100.0
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 100.0
PRK08056356 threonine-phosphate decarboxylase; Provisional 100.0
PRK03158359 histidinol-phosphate aminotransferase; Provisional 100.0
PLN03026380 histidinol-phosphate aminotransferase; Provisional 100.0
PRK08153369 histidinol-phosphate aminotransferase; Provisional 100.0
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 100.0
PRK07392360 threonine-phosphate decarboxylase; Validated 100.0
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 100.0
PRK09105370 putative aminotransferase; Provisional 100.0
PRK06836394 aspartate aminotransferase; Provisional 99.98
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.98
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.98
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.98
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.97
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.97
PRK08637388 hypothetical protein; Provisional 99.97
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.97
PRK06225380 aspartate aminotransferase; Provisional 99.97
PRK03321352 putative aminotransferase; Provisional 99.97
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.97
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.97
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.97
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.97
KOG0256471 consensus 1-aminocyclopropane-1-carboxylate syntha 99.97
KOG0634 472 consensus Aromatic amino acid aminotransferase and 99.97
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.97
PRK08354311 putative aminotransferase; Provisional 99.97
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.97
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.97
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.97
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.97
PRK07908349 hypothetical protein; Provisional 99.96
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.96
KOG0633375 consensus Histidinol phosphate aminotransferase [A 99.92
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.91
PRK13238 460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.91
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.88
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.88
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 99.88
COG2890280 HemK Methylase of polypeptide chain release factor 99.87
cd00617 431 Tnase_like Tryptophanase family (Tnase). This fami 99.87
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.86
KOG0258475 consensus Alanine aminotransferase [Amino acid tra 99.86
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.86
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.86
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.85
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.85
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.84
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.84
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.84
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.84
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.83
PLN02242 418 methionine gamma-lyase 99.83
PLN02822481 serine palmitoyltransferase 99.83
PRK07049 427 methionine gamma-lyase; Validated 99.83
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.83
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.82
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.82
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.82
KOG2904328 consensus Predicted methyltransferase [General fun 99.81
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.81
PRK13392410 5-aminolevulinate synthase; Provisional 99.79
PRK10534333 L-threonine aldolase; Provisional 99.79
PRK02627396 acetylornithine aminotransferase; Provisional 99.79
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.79
PLN02721353 threonine aldolase 99.79
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 99.79
PRK10874 401 cysteine sulfinate desulfinase; Provisional 99.78
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.78
TIGR02379 376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.78
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.77
TIGR03392 398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.77
PRK06234 400 methionine gamma-lyase; Provisional 99.77
cd00378 402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.77
PLN02483 489 serine palmitoyltransferase 99.77
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.77
PRK02948 381 cysteine desulfurase; Provisional 99.77
PRK06460 376 hypothetical protein; Provisional 99.76
PRK07179407 hypothetical protein; Provisional 99.76
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.76
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.75
PRK08776 405 cystathionine gamma-synthase; Provisional 99.75
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.74
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.74
PRK14967223 putative methyltransferase; Provisional 99.74
COG4123248 Predicted O-methyltransferase [General function pr 99.74
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.74
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 99.74
TIGR01979 403 sufS cysteine desulfurases, SufS subfamily. This m 99.73
PRK08249 398 cystathionine gamma-synthase; Provisional 99.73
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.73
PRK08247366 cystathionine gamma-synthase; Reviewed 99.73
PRK09295 406 bifunctional cysteine desulfurase/selenocysteine l 99.73
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.73
TIGR01976 397 am_tr_V_VC1184 cysteine desulfurase family protein 99.73
PRK08045 386 cystathionine gamma-synthase; Provisional 99.72
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.72
TIGR02080 382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.72
PRK09064407 5-aminolevulinate synthase; Validated 99.72
PRK07503 403 methionine gamma-lyase; Provisional 99.72
PLN02409 401 serine--glyoxylate aminotransaminase 99.71
PLN02855 424 Bifunctional selenocysteine lyase/cysteine desulfu 99.71
PRK00451 447 glycine dehydrogenase subunit 1; Validated 99.71
PRK06767 386 methionine gamma-lyase; Provisional 99.71
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 99.71
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.71
PRK07811 388 cystathionine gamma-synthase; Provisional 99.71
PRK07504 398 O-succinylhomoserine sulfhydrylase; Reviewed 99.7
PRK11706 375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.7
PRK13479 368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.7
TIGR01325 380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.69
cd06453 373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.69
TIGR01328 391 met_gam_lyase methionine gamma-lyase. This model d 99.69
TIGR01326 418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.68
PRK00011 416 glyA serine hydroxymethyltransferase; Reviewed 99.68
cd00614 369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.68
PRK11658 379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.68
PRK14968188 putative methyltransferase; Provisional 99.68
PRK08574 385 cystathionine gamma-synthase; Provisional 99.67
PRK08861 388 cystathionine gamma-synthase; Provisional 99.67
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.67
PRK13393406 5-aminolevulinate synthase; Provisional 99.67
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.67
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.66
TIGR01977 376 am_tr_V_EF2568 cysteine desulfurase family protein 99.66
PRK07050 394 cystathionine beta-lyase; Provisional 99.65
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 99.65
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.64
PLN03227 392 serine palmitoyltransferase-like protein; Provisio 99.64
PRK05939 397 hypothetical protein; Provisional 99.64
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.63
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.63
PRK07505402 hypothetical protein; Provisional 99.63
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.62
TIGR03403 382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.62
PRK07582366 cystathionine gamma-lyase; Validated 99.62
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.62
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 99.62
PRK14012 404 cysteine desulfurase; Provisional 99.62
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.61
PRK13520371 L-tyrosine decarboxylase; Provisional 99.61
PRK07671 377 cystathionine beta-lyase; Provisional 99.61
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.61
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.61
TIGR01329 378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.61
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.6
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.6
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.6
PRK08064 390 cystathionine beta-lyase; Provisional 99.6
PRK05968 389 hypothetical protein; Provisional 99.59
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.59
PRK06702 432 O-acetylhomoserine aminocarboxypropyltransferase; 99.58
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.58
PRK09028 394 cystathionine beta-lyase; Provisional 99.58
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.57
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 99.57
PRK06176 380 cystathionine gamma-synthase/cystathionine beta-ly 99.57
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 99.57
TIGR03402 379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.56
TIGR03531 444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.56
TIGR01324 377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.56
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.56
PLN02955476 8-amino-7-oxononanoate synthase 99.56
PLN02509 464 cystathionine beta-lyase 99.55
PRK06084 425 O-acetylhomoserine aminocarboxypropyltransferase; 99.55
PLN02651364 cysteine desulfurase 99.55
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.55
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.54
PRK05967 395 cystathionine beta-lyase; Provisional 99.54
PHA03411279 putative methyltransferase; Provisional 99.54
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.54
TIGR03588 380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.54
PRK07269364 cystathionine gamma-synthase; Reviewed 99.53
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.53
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.53
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 99.52
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.52
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.51
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.51
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 99.49
PRK04260375 acetylornithine aminotransferase; Provisional 99.49
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.49
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.49
cd00616 352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.49
PRK04366 481 glycine dehydrogenase subunit 2; Validated 99.48
PLN00144382 acetylornithine transaminase 99.47
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.46
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.46
COG0399 374 WecE Predicted pyridoxal phosphate-dependent enzym 99.46
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.43
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.43
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.43
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.43
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.43
PRK05994 427 O-acetylhomoserine aminocarboxypropyltransferase; 99.43
COG0520 405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.42
PHA03412241 putative methyltransferase; Provisional 99.42
PRK09792421 4-aminobutyrate transaminase; Provisional 99.41
PLN02233261 ubiquinone biosynthesis methyltransferase 99.41
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.41
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.41
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.41
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.41
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.41
PLN02244340 tocopherol O-methyltransferase 99.39
PF01041 363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.39
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.39
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 99.39
PRK11207197 tellurite resistance protein TehB; Provisional 99.38
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.38
PLN02490340 MPBQ/MSBQ methyltransferase 99.37
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.37
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.37
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 99.36
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.36
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.36
PLN02624 474 ornithine-delta-aminotransferase 99.36
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.36
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.36
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.35
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.35
TIGR03438301 probable methyltransferase. This model represents 99.35
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.35
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.35
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.34
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.34
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.34
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.34
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.34
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.33
PRK13034 416 serine hydroxymethyltransferase; Reviewed 99.33
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.33
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.32
TIGR02618 450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.32
PRK08114 395 cystathionine beta-lyase; Provisional 99.32
PRK07812 436 O-acetylhomoserine aminocarboxypropyltransferase; 99.32
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.31
TIGR00452314 methyltransferase, putative. Known examples to dat 99.31
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.3
PRK14902444 16S rRNA methyltransferase B; Provisional 99.3
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 99.29
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.29
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.28
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.28
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.28
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.27
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.27
PF01053 386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.27
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.27
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.27
PRK07402196 precorrin-6B methylase; Provisional 99.26
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.26
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.25
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.25
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.25
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 99.25
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.24
PRK10901427 16S rRNA methyltransferase B; Provisional 99.24
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.23
PLN02336475 phosphoethanolamine N-methyltransferase 99.23
PRK12335287 tellurite resistance protein TehB; Provisional 99.23
COG1041347 Predicted DNA modification methylase [DNA replicat 99.23
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.23
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 99.23
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.22
PRK13237 460 tyrosine phenol-lyase; Provisional 99.21
PRK06434 384 cystathionine gamma-lyase; Validated 99.21
PRK14904445 16S rRNA methyltransferase B; Provisional 99.21
PRK04266226 fibrillarin; Provisional 99.2
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.2
PRK14903431 16S rRNA methyltransferase B; Provisional 99.2
TIGR01814406 kynureninase kynureninase. This model describes ky 99.2
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.19
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.17
PRK06922677 hypothetical protein; Provisional 99.17
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.16
KOG2899288 consensus Predicted methyltransferase [General fun 99.16
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.15
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.15
COG1104 386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.15
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 99.15
PRK14901434 16S rRNA methyltransferase B; Provisional 99.15
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.14
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 99.14
KOG1549 428 consensus Cysteine desulfurase NFS1 [Amino acid tr 99.14
KOG0053 409 consensus Cystathionine beta-lyases/cystathionine 99.14
PRK04311464 selenocysteine synthase; Provisional 99.14
COG0626 396 MetC Cystathionine beta-lyases/cystathionine gamma 99.13
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.13
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.13
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.13
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.11
PRK13580 493 serine hydroxymethyltransferase; Provisional 99.1
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.1
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.1
PRK08317241 hypothetical protein; Provisional 99.1
PRK04457262 spermidine synthase; Provisional 99.1
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.09
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 99.09
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.08
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.08
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.08
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.07
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.07
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 99.07
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.06
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.06
TIGR00438188 rrmJ cell division protein FtsJ. 99.06
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.05
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.05
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 99.04
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.04
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.03
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.03
PLN03075296 nicotianamine synthase; Provisional 99.03
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.03
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.02
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.02
PRK03612521 spermidine synthase; Provisional 99.02
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.01
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.0
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 99.0
PRK05785226 hypothetical protein; Provisional 99.0
PRK00811283 spermidine synthase; Provisional 99.0
PRK01581374 speE spermidine synthase; Validated 99.0
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.0
COG0075 383 Serine-pyruvate aminotransferase/archaeal aspartat 98.99
KOG1271227 consensus Methyltransferases [General function pre 98.99
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.99
KOG1368384 consensus Threonine aldolase [Amino acid transport 98.98
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.98
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 98.97
PRK15029 755 arginine decarboxylase; Provisional 98.97
PRK03715395 argD acetylornithine transaminase protein; Provisi 98.96
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.96
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.96
PTZ00094 452 serine hydroxymethyltransferase; Provisional 98.95
PRK02769380 histidine decarboxylase; Provisional 98.95
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 98.94
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.94
PLN03032374 serine decarboxylase; Provisional 98.94
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.94
COG4122219 Predicted O-methyltransferase [General function pr 98.93
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.93
PLN02476278 O-methyltransferase 98.93
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.92
PTZ00146293 fibrillarin; Provisional 98.92
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.92
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.91
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.91
COG2873 426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 98.91
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.91
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.91
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.9
PRK06202232 hypothetical protein; Provisional 98.9
TIGR02987524 met_A_Alw26 type II restriction m6 adenine DNA met 98.9
PRK08593445 4-aminobutyrate aminotransferase; Provisional 98.89
PRK06541460 hypothetical protein; Provisional 98.87
PLN02336475 phosphoethanolamine N-methyltransferase 98.87
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.86
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.86
KOG1360 570 consensus 5-aminolevulinate synthase [Coenzyme tra 98.86
PLN03226 475 serine hydroxymethyltransferase; Provisional 98.86
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.85
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.85
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 98.84
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.84
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 98.83
PLN02414 993 glycine dehydrogenase (decarboxylating) 98.82
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.82
COG0076 460 GadB Glutamate decarboxylase and related PLP-depen 98.82
PRK13578 720 ornithine decarboxylase; Provisional 98.82
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.82
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.81
PLN02366308 spermidine synthase 98.8
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.8
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.8
PRK15400 714 lysine decarboxylase CadA; Provisional 98.76
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.76
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.74
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.74
COG0112 413 GlyA Glycine/serine hydroxymethyltransferase [Amin 98.74
KOG4300252 consensus Predicted methyltransferase [General fun 98.74
COG2521287 Predicted archaeal methyltransferase [General func 98.74
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.73
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 98.72
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.72
PRK05769441 4-aminobutyrate aminotransferase; Provisional 98.72
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.72
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.72
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.71
PF06838 403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 98.69
PLN02589247 caffeoyl-CoA O-methyltransferase 98.69
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 98.69
PLN02271 586 serine hydroxymethyltransferase 98.68
KOG2361264 consensus Predicted methyltransferase [General fun 98.68
PRK15399 713 lysine decarboxylase LdcC; Provisional 98.68
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 98.67
COG2520341 Predicted methyltransferase [General function pred 98.66
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 98.65
PLN02724 805 Molybdenum cofactor sulfurase 98.64
TIGR02617 467 tnaA_trp_ase tryptophanase, leader peptide-associa 98.63
PLN02263470 serine decarboxylase 98.62
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 98.62
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 98.61
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 98.61
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.61
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 98.6
KOG1499346 consensus Protein arginine N-methyltransferase PRM 98.59
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 98.58
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.57
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 98.57
PLN02590 539 probable tyrosine decarboxylase 98.56
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.54
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 98.54
KOG1500517 consensus Protein arginine N-methyltransferase CAR 98.54
PRK12403460 putative aminotransferase; Provisional 98.54
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.53
PRK07046453 aminotransferase; Validated 98.52
PLN02823336 spermine synthase 98.52
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 98.51
PRK05965459 hypothetical protein; Provisional 98.51
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.51
PLN02760504 4-aminobutyrate:pyruvate transaminase 98.51
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 98.5
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 98.5
PRK06082459 4-aminobutyrate aminotransferase; Provisional 98.5
TIGR03799 522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 98.49
>PLN02672 methionine S-methyltransferase Back     alignment and domain information 
Probab=100.00  E-value=2.7e-205  Score=1850.72  Aligned_cols=895  Identities=77%  Similarity=1.239  Sum_probs=818.9

Q ss_pred             CcccCCcccCcchhHHHHHHhhcCCCCCCCCCeEEEeCCccCHHHHHHHHHhCCCEEEEEeCCHHHHHHHHHHHHhcccc
Q 043334            1 MMVIPSIFIPEDWSFTFYEGLNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALD   80 (903)
Q Consensus         1 ~~~~p~vfiP~~w~~~~~~~L~~~~~~~~~~~~VLDlGCGtG~lsi~la~~~~~~~V~giDis~~al~~A~~n~~~~gl~   80 (903)
                      ++|.|+|||||+|++.+.+.|...++..+++.+|||+|||+|.+++.+++.++..+|+|+|+|+++++.|++|++.|+++
T Consensus        89 ~~V~p~VLIPRpeTE~lve~L~~~~~~~~~~~~VLDlG~GSG~Iai~La~~~~~~~v~avDis~~Al~~A~~Na~~n~l~  168 (1082)
T PLN02672         89 MMEIPSIFIPEDWSFTFYEGLNRHPDSIFRDKTVAELGCGNGWISIAIAEKWLPSKVYGLDINPRAVKVAWINLYLNALD  168 (1082)
T ss_pred             eeeCCCcccCchhHHHHHHHHHhcccccCCCCEEEEEecchHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHcCcc
Confidence            57999999999999999999877666556678999999999999999999988889999999999999999999999875


Q ss_pred             cCCCCcchhhhcccCCcEEEEEccccccccCCCCceeEEEECCCCCCCCCccchhhHHhhhhhhhhhhhccccccccccc
Q 043334           81 EKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPDAMSKIITENASEEFLYSLSNYCALQGFV  160 (903)
Q Consensus        81 ~~~~~~~~~~~~~~~~~v~~~~gDl~~~~~~~~~~fD~Iv~NpPy~~~~~~~~l~~~~~~~~~~~~~~~l~~~~al~~~v  160 (903)
                      +.+.+.++.+++.+.++++++++|+.+......++||+||+||||+..++...+.+++.++.|++|+++++|++++++++
T Consensus       169 ~~~~~~~~~~~~~l~~rV~f~~sDl~~~~~~~~~~fDlIVSNPPYI~~~e~~~l~~eV~~~ep~~~~~~~~p~~AL~g~~  248 (1082)
T PLN02672        169 DDGLPVYDGEGKTLLDRVEFYESDLLGYCRDNNIELDRIVGCIPQILNPNPEAMSKLVTENASEEFLYSLSNYCALQGFV  248 (1082)
T ss_pred             cccccccccccccccccEEEEECchhhhccccCCceEEEEECCCcCCCcchhhcChhhhhccccccccccCccccccCCC
Confidence            44444555555556678999999999876433237999999999999999888999999999999999999999999999


Q ss_pred             cccccHHHHHHHHHHHhhcccCCcEEEEEeCCCCcHHHHHHHHHHCCCeEEEEEehhhhccCCCcccCCCCcceeeeeec
Q 043334          161 EDQFGLGLIARAVEEGIGVIKPSGIMIFNMGGRPGQGVCKRLFERRGFRVDKLWQTKILQASEPFFASDTDISALVEIEK  240 (903)
Q Consensus       161 ~~~~g~~~~~~~l~~~~~~LkpgG~ll~~~~~~~~~~~l~~ll~~~gf~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~e~  240 (903)
                      ++.+|+++++++++++.++|+|||.++++++..+++...++++++.||+...+|+.++.|+      .++||++++++||
T Consensus       249 ~g~dGL~~yr~i~~~a~~~L~pgG~l~lEiG~~q~~~v~~~l~~~~gf~~~~~~~~~~~~~------~~~~~~~~~~~~~  322 (1082)
T PLN02672        249 EDQFGLGLIARAVEEGISVIKPMGIMIFNMGGRPGQAVCERLFERRGFRITKLWQTKINQA------ADTDISALVEIEK  322 (1082)
T ss_pred             CCCcHHHHHHHHHHHHHHhccCCCEEEEEECccHHHHHHHHHHHHCCCCeeEEeeehhhhc------cccchHHHHHHhh
Confidence            9999999999999999999999999999999999988754699999999999999999999      9999999999999


Q ss_pred             cCCcceeEEecccCCCcccHHHHHHhhhcCcceeeeeeeeeccccCchhHHHHHHHHhcccccccccccccccccccccc
Q 043334          241 NSPHRFEFFMGLSGDLPICARTAWAYGKAGGRISHALSVYSCQLHQPNQVKKIFKFLKNGFHEISSSLDLSFEDDSVADE  320 (903)
Q Consensus       241 ~~~~~f~f~~~~~~~~p~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~l~~g~~~~~~~~d~~~~~~~~~~~  320 (903)
                      |++|+|||||++++++|+||||||+|+|+||+|+|++|||+||+++|+|+|+|++|||+||+++++++||+|+|+++++|
T Consensus       323 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  402 (1082)
T PLN02672        323 NSRHRFEFFMGLVGDQPICARTAWAYGKAGGRISHALSVYSCQLRQPNQVKTIFKFLKNGFHEVSGSLDLSFEDESVADE  402 (1082)
T ss_pred             cCccceeeeeccCCCCchhHHHHHHHHhcCCccchhhhhhhhhhcCchHHHHHHHHHHccchhhhhhccccccccccchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccchHHHHHHHhhcCCCCCCCCCCcChhHHHHHHHHhhhcCcccCCCCceEEecchHHHHHHhhhhcccceeeecccccc
Q 043334          321 KIPFLAYLASVLKERSFFPYEPPAGSKRFRNLIADFMKKYHHIPLNADNVVVFPSRAVAIENALRLFSPRLAIVDERLTR  400 (903)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  400 (903)
                      ||+|+|+||++||++|||||||||||++||||||||||+|||||||+|||||||||||||||+||||||||||||||+||
T Consensus       403 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  482 (1082)
T PLN02672        403 KIPFLAYLASALKGLSYFPCEPPAGSKRFRNLIAGFMRIYHHIPLTPDNVVVFPSRAVAIENALRLFSPRLAIVDEHLTR  482 (1082)
T ss_pred             hccHHHHHHHHHccCCCCCCCCCccchHHHHHHHHHHHHhcCCcCCccceEEeccHHHHHHHHHHhhChHHHhhhhhhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcchhhhhhcccCCCCCCCCCCeeEEeeCCcchhHHHHHHHhcCCeEEEeecccchhccHHHHHHHHHHHhhccceEEe
Q 043334          401 HLPKHWLTSLTIKGTDTENSSEHELTVIEAPRQSDLMVELIKKLKPQVVISGIGDFEAVTSSAFVHLLDVTREVGSRLFL  480 (903)
Q Consensus       401 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~  480 (903)
                      ||||+|||+|++|++.++++++++|||||||||||||||||||+|||||||||++||++||+||||||++|+++|+||||
T Consensus       483 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  562 (1082)
T PLN02672        483 WLPKKWLTSLAIENATSDSKSDDVITVIEAPRQSDLVIELIKKLKPQVVVTGMADFEMRTSTAFEHLLNVTAEIGARLFL  562 (1082)
T ss_pred             cCCHHHHhHhhhhcccccCccCCeEEEEeCCCcchHHHHHHHhCCCeEEEEeccchhhhhHHHHHHHHHHHHhhCcEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecccccccccCCCchhHhhhhhcCCCCchhHhhhhhhcccccCCceeeeeccchHHHHHHhhhhhhhhccchhhhhHhhH
Q 043334          481 DISDHFELSSLPSSNGVLKYLAGNVLPSHAAVICGLVKNQVYSDLEVAFLISEEEAIFKALSKTVEVLEGTTALISQNYY  560 (903)
Q Consensus       481 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~  560 (903)
                      ||||||||||+|+||||||||||++|||||+|||||||||||+||||||+|||++++++||+||+||||||||+++|+||
T Consensus       563 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  642 (1082)
T PLN02672        563 DISDHLELSSLPGSNGVLKYLAGHPLPSHAAIICGLVKNQVYSDLEVAFVISENEAVLKALSKTGEVLEGRTAIISQFYY  642 (1082)
T ss_pred             ehhhheeeccCCCcccHHHHhcCCCCCcchhHhhhhhhccccccceEEEEecCcHHHHHHHHHHHHhhccchHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHhhcccCCCccchhhHHhhhhccCCCCHHHHHHHHhhhhccCCCCCeEEccCCCCCCCCcHHHHHHHHHH
Q 043334          561 GCLFHELLAFQLAERHTHKERDCEKAKSTEMIGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFES  640 (903)
Q Consensus       561 ~~~~~~~l~~~~~~~~~~~~r~~~~~~s~~~~~l~~s~i~~l~~a~~a~~~~~~~~~IdLs~g~p~~~~p~~v~~al~~a  640 (903)
                      ||+|||||+||+++|||+++|.+++..+.++.+++.+....+..++..+....++++|+|++|+|++++|+.+++++.++
T Consensus       643 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~g~~vI~LsinE~d~ppPp~V~eAi~ea  722 (1082)
T PLN02672        643 GCLFHELLAFQLADRHTPQERLPEEEESSKFIGFSSSARSALKEAELSVSGSQESSLIHMDVDESFLPVPSAVKASIFES  722 (1082)
T ss_pred             HHHHHHHHhccCCCCCCCccccchhhhhHhhhCCCchhHHHHHhcccCCcccCCCCEEEEeCCCCCCCCCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999987655444556789999999999999999999999988


Q ss_pred             HHccCCCCCchHHHHHHHHHHHhhcCCCCCCCCcEEecCchHHHHHHHHHHhccCCCeEEEcCCCcHHHHHHHHHcCCEE
Q 043334          641 FARQNMSESEIDVTPSIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANI  720 (903)
Q Consensus       641 l~~y~~~~G~~~lr~ala~~l~~~~G~~~~pe~~I~vt~Gs~~al~~ll~~l~~pGD~Vlv~~P~y~~~~~~~~~~G~~v  720 (903)
                      +.++....|++++++++++++++++|++.+++++|++|+|+++++..++.++++|||.|+++.|+|+.|...++..|+++
T Consensus       723 l~~~~~s~g~pdlr~aLa~~la~~~Gv~~d~~e~IIvt~Gs~elL~lll~aLl~pGD~VLVp~PtY~~Y~~~a~~~Ga~v  802 (1082)
T PLN02672        723 FVRQNISESETDPRPSILQFIKSNYGFPTDSCTEFVYGDTSLALFNKLVLCCVQEGGTLCFPAGSNGTYVSAAKFLKANF  802 (1082)
T ss_pred             HhhcCCCCCChHHHHHHHHHHHHHhCcCCCCCCEEEEeCCHHHHHHHHHHHHcCCCCEEEEeCCChHHHHHHHHHcCCEE
Confidence            76665567889999999999999999998765689999999999999999999999999999999999999999999999


Q ss_pred             EEecCCCCCCcccCHHHHHHHhhcCCCcEEEEECCCCCCcccCCCHHHHHHHHHHHHhCCcEEEEecCCCCCccCCCCCC
Q 043334          721 VNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWG  800 (903)
Q Consensus       721 v~v~~~~~~~f~ld~~~L~~~l~~~~~~~vil~~P~~NPTG~v~s~eel~eI~~ia~k~~i~VI~DeaY~~l~f~~~~~s  800 (903)
                      +.+|++++++|.+|++.+++++++.+++++++++|||||||.++|.+++++|+++|++||++||+||+|+++.|++..++
T Consensus       803 v~Vpl~~e~gf~lD~d~Le~al~~~~~~~I~L~nPnhNPTG~v~S~eeLe~Llela~k~di~VIsDEaYsdL~Fd~~~~s  882 (1082)
T PLN02672        803 RRIPTKSSDGFKLTAKTLASTLETVKKPWVYISGPTINPTGLLYSNSEIEEILSVCAKYGARVIIDTSFSGLEYDTSGWG  882 (1082)
T ss_pred             EEEecccccCCCCCHHHHHHHhccCCCCEEEEECcCCCCcCccCCHHHHHHHHHHHHHcCCEEEEeCCCCccccCCCCCc
Confidence            99999866789999999999987644458999999779999999999999999999999999999999999999775432


Q ss_pred             CCchhhhhhhhccCCCCCCceEEEccCchhcccccceeeEEEeCcHHHHHHHHhCCCCCCCcHHHHHHHHHHHhcccccc
Q 043334          801 GWDLEGCLSKLYSSTNSSFNVSLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPGLSKPHSTVRYAIKKLLGLRERKA  880 (903)
Q Consensus       801 ~~s~~~~~~~l~~~~~~~~~vI~l~S~SK~~g~~GlRiG~lv~~~~~li~~l~~~~~~~~~s~~~Q~aa~~~L~~~~~~~  880 (903)
                      .+++.+....++... ++.++|+++||||.|++||||+||++++++.+++.+.+......++...|.++..++.......
T Consensus       883 ~~sl~s~l~~~~~~s-ks~nVIvL~SfSKkf~lpGLRIGylIap~~eLi~~l~~~~~~s~~~~~~q~Aaaaalall~~~~  961 (1082)
T PLN02672        883 GWDLKSILSRLKSSN-PSFAVALLGGLSTELLSGGHEFGFLALNDSVLIDAFHSAPGLSRPHSTLKYTIKKLLGLKNQKS  961 (1082)
T ss_pred             ccchhhHHHHhcccc-CCceEEEEeCcHHhhccHHHHheeEEeCCHHHHHHHHHhhhhcCCCcHHHHHHHHHHHHHhccC
Confidence            233333333332210 1248999999999999999999999998766899998875555555567777766663111011


Q ss_pred             hhHHHHHHHHHHHHHHHHHHHh
Q 043334          881 RDLMNAVAEHIRNLESRSKRLK  902 (903)
Q Consensus       881 ~~~~~~l~~~r~~y~~Rr~~l~  902 (903)
                      ..+.+++.+.++.|++||+++.
T Consensus       962 ~~~~~~l~e~r~~Lk~rRd~L~  983 (1082)
T PLN02672        962 SDLLDGVAEQKKILKSRAERLK  983 (1082)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHH
Confidence            2456788899999999999875

>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query903
2x5d_A412 Crystal Structure Of A Probable Aminotransferase Fr 5e-05
1j32_A388 Aspartate Aminotransferase From Phormidium Lapideum 1e-04
>pdb|2X5D|A Chain A, Crystal Structure Of A Probable Aminotransferase From Pseudomonas Aeruginosa Length = 412 Back     alignment and structure 
Iteration: 1

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 85/203 (41%), Gaps = 22/203 (10%)
Query: 656 SIQQYIKSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARF 715
           +I  + +  +   ID  +E I    S+     L+L  +  G T+  P  S   ++  A  
Sbjct: 83  AISHWYRDRYDVQIDPESEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVI 142
Query: 716 LKANIVNIPTESEVGFKMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTV 775
             A + ++P    + F    +    I E++ KP + I G   NPT         E ++ +
Sbjct: 143 AGAQVRSVPLVPGIDF--FNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVAL 200
Query: 776 CAKYGARVVIDTAFSGLEFNYEGWGG---WDLEGC--LSKLYSSTNSSFNVSLLGGLSLK 830
             +Y   VV D A++  +  Y+GW       + G   ++  + + + S+N++        
Sbjct: 201 AKQYDVMVVHDLAYA--DIVYDGWKAPSIMQVPGAKDIAVEFFTLSKSYNMA-------- 250
Query: 831 MLTGALKFGFLVLNHPQLVDAFS 853
                 + GF+V N P+LV A +
Sbjct: 251 ----GWRIGFMVGN-PELVSALA 268
>pdb|1J32|A Chain A, Aspartate Aminotransferase From Phormidium Lapideum Length = 388 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query903
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 8e-09
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 2e-08
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 4e-08
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 8e-08
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 8e-08
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 2e-07
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 4e-07
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 1e-04
3g0t_A 437 Putative aminotransferase; NP_905498.1, putative a 6e-07
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 8e-07
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 9e-07
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 1e-06
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 1e-06
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 7e-05
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 2e-06
3i9f_A170 Putative type 11 methyltransferase; structural gen 3e-06
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 3e-06
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 3e-06
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 4e-06
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 6e-06
3lpm_A259 Putative methyltransferase; structural genomics, p 1e-05
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 1e-05
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 2e-05
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 3e-05
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 3e-05
3dh0_A219 SAM dependent methyltransferase; cystal structure, 4e-05
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 4e-05
3ftb_A361 Histidinol-phosphate aminotransferase; structural 4e-05
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 5e-05
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 6e-05
2zy4_A 546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 6e-05
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 6e-05
3f4k_A257 Putative methyltransferase; structural genomics, P 8e-05
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 8e-05
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 9e-05
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 1e-04
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 1e-04
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 1e-04
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 1e-04
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 2e-04
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 2e-04
1xi9_A406 Putative transaminase; alanine aminotransferase, s 2e-04
3ele_A398 Amino transferase; RER070207001803, structural gen 2e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
1ne2_A200 Hypothetical protein TA1320; structural genomics, 3e-04
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 3e-04
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 3e-04
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 3e-04
2b3t_A276 Protein methyltransferase HEMK; translation termin 3e-04
3ocj_A305 Putative exported protein; structural genomics, PS 4e-04
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 6e-04
3nra_A407 Aspartate aminotransferase; structural genomics, j 6e-04
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 6e-04
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 6e-04
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 6e-04
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 7e-04
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 7e-04
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 8e-04
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 Back     alignment and structure
 Score = 65.4 bits (158), Expect = 2e-11
 Identities = 29/112 (25%), Positives = 45/112 (40%)

Query: 21  LNRHPDSILKDKTVAELGCGNGWITIAIAEKWLPSKVYGLDINPRAIRISWINLYLNALD 80
           L        + + V +LGC  G +T++IA KW PS++ GLDI+ R I  +  N+     +
Sbjct: 37  LRVLKPEWFRGRDVLDLGCNVGHLTLSIACKWGPSRMVGLDIDSRLIHSARQNIRHYLSE 96

Query: 81  EKGQPIYDAEKKTLLDRVEFHESDLLAYCRDHDIQLERIVGCIPQILNPNPD 132
           E   P    E     +  E   +     C    +   R     PQ+     D
Sbjct: 97  ELRLPPQTLEGDPGAEGEEGTTTVRKRSCFPASLTASRGPIAAPQVPLDGAD 148
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Length = 194 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Length = 375 Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Length = 364 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Length = 284 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Length = 409 Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Length = 391 Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Length = 428 Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Length = 428 Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Length = 437 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Length = 435 Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Length = 435 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Length = 343 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Length = 389 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Length = 500 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Length = 381 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Length = 230 Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Length = 375 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Length = 170 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} Length = 361 Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Length = 385 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Length = 546 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Length = 389 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Length = 241 Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Length = 444 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Length = 350 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Length = 406 Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Length = 398 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Length = 200 Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Length = 533 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Length = 205 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Length = 276 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Length = 407 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Length = 254 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Length = 388 Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Length = 427 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Length = 215 Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Length = 416 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query903
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 100.0
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 100.0
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 100.0
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 100.0
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 100.0
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 100.0
3b46_A 447 Aminotransferase BNA3; kynurenine aminotransferase 100.0
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 100.0
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 100.0
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 100.0
3aow_A448 Putative uncharacterized protein PH0207; protein-P 100.0
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 100.0
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 100.0
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 100.0
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 100.0
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 100.0
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 100.0
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 100.0
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 100.0
2o0r_A 411 RV0858C (N-succinyldiaminopimelate aminotransfera; 100.0
3rq1_A418 Aminotransferase class I and II; structural genomi 100.0
3ele_A398 Amino transferase; RER070207001803, structural gen 100.0
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 100.0
1xi9_A406 Putative transaminase; alanine aminotransferase, s 100.0
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 100.0
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 100.0
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 100.0
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 100.0
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 100.0
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.98
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.98
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.98
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.98
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.98
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.98
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.98
3ihj_A 498 Alanine aminotransferase 2; helix, structural geno 99.97
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.97
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.97
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.97
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.97
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.97
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.97
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.97
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.97
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.97
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.97
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.97
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.97
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.97
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.97
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.97
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.97
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.97
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.97
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.97
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.97
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.97
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.97
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.97
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.97
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.97
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.97
2zy4_A 546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.97
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.96
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.96
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.96
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.96
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.96
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.96
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.96
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.93
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.96
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.96
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.96
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.96
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.95
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.95
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.95
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.95
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.94
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.93
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.9
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.9
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.9
1e5e_A 404 MGL, methionine gamma-lyase; methionine biosynthes 99.9
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.89
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.89
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 99.89
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.89
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.88
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.88
2rfv_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.88
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.88
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 99.88
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 99.88
1svv_A359 Threonine aldolase; structural genomics, structura 99.87
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.87
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.87
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.87
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.87
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.86
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.86
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.86
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.86
4eb5_A 382 Probable cysteine desulfurase 2; scaffold, transfe 99.86
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.86
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.85
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.85
1b9h_A 388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.85
3zrp_A 384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.85
3vax_A 400 Putative uncharacterized protein DNDA; desulfurase 99.85
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.85
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.85
2huf_A 393 Alanine glyoxylate aminotransferase; alpha and bet 99.85
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.84
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.84
4hvk_A 382 Probable cysteine desulfurase 2; transferase and I 99.84
2z9v_A 392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.84
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.84
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.84
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.84
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 99.84
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.84
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.84
1ibj_A 464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.83
3nnk_A 411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.83
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.83
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.83
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.82
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 99.82
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.82
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.82
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.81
2dkj_A 407 Serine hydroxymethyltransferase; PLP dependent enz 99.81
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.81
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.81
2ez2_A 456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.81
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.81
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.81
2bkw_A 385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.81
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.81
2cy8_A 453 D-phgat, D-phenylglycine aminotransferase; structu 99.8
3ndn_A 414 O-succinylhomoserine sulfhydrylase; seattle struct 99.8
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.8
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 99.8
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.8
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.8
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.8
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.8
1cs1_A 386 CGS, protein (cystathionine gamma-synthase); lyase 99.8
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.8
3cog_A 403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.79
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.79
1pff_A 331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.79
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.79
3acz_A 389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.79
1gc0_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.79
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 99.79
3qhx_A 392 Cystathionine gamma-synthase METB (CGS); structura 99.78
1wyu_B 474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.78
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.78
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.78
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.78
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.78
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.78
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.78
1qz9_A 416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.78
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.78
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.77
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.77
3dr4_A 391 Putative perosamine synthetase; deoxysugar, pyrido 99.77
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.77
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.77
1qgn_A 445 Protein (cystathionine gamma-synthase); methionine 99.77
1n8p_A 393 Cystathionine gamma-lyase; three open alpha/beta s 99.76
3uwc_A 374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.76
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.76
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.76
3ht4_A 431 Aluminum resistance protein; lyase, putative cysta 99.76
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.76
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.76
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.75
1o69_A 394 Aminotransferase; structural genomics, unknown fun 99.75
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.75
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.75
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.75
3ju7_A 377 Putative PLP-dependent aminotransferase; NP_978343 99.75
2cb1_A 412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.75
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.75
3hmu_A 472 Aminotransferase, class III; structural genomics, 99.74
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.74
3jzl_A 409 Putative cystathionine beta-lyase involved in ALU 99.73
3gbx_A 420 Serine hydroxymethyltransferase; structural genomi 99.73
2fq6_A 415 Cystathionine beta-lyase; protein-inhibitor comple 99.73
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.73
3e9k_A 465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.72
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.72
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.72
2vi8_A 405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.72
2fnu_A 375 Aminotransferase; protein-product complex, structu 99.72
3lpm_A259 Putative methyltransferase; structural genomics, p 99.71
3ri6_A 430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.71
3nmy_A 400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.71
3frk_A 373 QDTB; aminotransferase, sugar-modification, natura 99.71
3i16_A 427 Aluminum resistance protein; YP_878183.1, carbon-s 99.7
3hvy_A 427 Cystathionine beta-lyase family protein, YNBB B.S 99.7
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.7
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.69
2h00_A254 Methyltransferase 10 domain containing protein; st 99.68
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.68
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.67
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.66
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.66
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.64
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.62
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.62
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.62
3vp6_A 511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.62
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.62
3b8x_A 390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.61
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.61
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.59
1wyu_A 438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.58
3ke3_A 379 Putative serine-pyruvate aminotransferase; structu 99.57
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 99.57
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.57
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.56
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.55
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.55
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.55
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.55
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.55
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.55
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.55
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.55
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.54
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.54
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.53
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.53
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.53
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.53
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.53
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.52
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.28
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.52
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.51
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.49
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.49
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.49
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.49
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.49
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.49
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.49
3f4k_A257 Putative methyltransferase; structural genomics, P 99.48
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.48
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.48
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.48
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.48
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.48
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.47
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.47
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.47
3ocj_A305 Putative exported protein; structural genomics, PS 99.47
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.46
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.46
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.46
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.45
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.45
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.45
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.45
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.45
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.44
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.44
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.44
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.43
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.43
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.43
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.43
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.43
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.42
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.42
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.42
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.42
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.42
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.42
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.41
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.41
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.41
3lcc_A235 Putative methyl chloride transferase; halide methy 99.41
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.41
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.41
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.41
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.41
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.41
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.41
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.41
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.41
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.4
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.4
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.4
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.4
3k6r_A278 Putative transferase PH0793; structural genomics, 99.4
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.4
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.39
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.39
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.39
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.39
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.39
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.38
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.38
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.38
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.38
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.38
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.38
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.38
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.37
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.37
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.37
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.36
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.36
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 99.36
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.36
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.36
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.36
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.36
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.36
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.35
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.35
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.35
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.35
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.35
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.34
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 99.34
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.34
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.34
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.34
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.34
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.34
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.33
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.33
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.33
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.33
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.33
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.32
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.32
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.31
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.31
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 99.31
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.31
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.31
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.31
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.31
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.31
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.31
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.31
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.31
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.31
2pt6_A321 Spermidine synthase; transferase, structural genom 99.31
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.3
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.3
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.3
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.3
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.3
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.29
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.29
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.29
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.29
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.29
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.29
3lkd_A542 Type I restriction-modification system methyltrans 99.29
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.28
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.28
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.28
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.28
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.28
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.27
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.27
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.26
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.26
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.26
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.26
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.26
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.25
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.25
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.24
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.24
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.24
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.24
3gjy_A317 Spermidine synthase; APC62791, structural genomics 99.24
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.24
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.24
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.24
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.23
3khk_A544 Type I restriction-modification system methylation 99.23
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.22
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.22
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.22
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.22
2o07_A304 Spermidine synthase; structural genomics, structur 99.22
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.22
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.22
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.22
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 99.22
3s1s_A878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 99.22
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.22
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.21
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.21
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.21
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.21
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.21
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.21
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 99.21
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.2
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 99.2
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.2
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.2
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.2
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.2
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 99.2
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.19
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.19
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.19
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.19
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.19
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.19
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.19
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.18
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.18
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.18
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.17
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.17
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.17
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.17
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.16
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.16
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.16
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.16
2b25_A336 Hypothetical protein; structural genomics, methyl 99.16
2i7c_A283 Spermidine synthase; transferase, structural genom 99.15
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.15
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.15
3cc8_A230 Putative methyltransferase; structural genomics, j 99.15
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.14
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.14
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.13
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.12
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.12
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.11
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.1
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.1
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.1
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.1
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.1
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.09
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.09
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.08
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.07
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.07
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.06
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.05
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 99.05
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.04
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.03
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.03
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.03
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 99.03
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.02
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 99.01
3bc8_A 450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.0
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.0
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.98
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.98
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.97
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.97
3ufb_A530 Type I restriction-modification system methyltran 98.96
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.95
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.95
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.95
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.95
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.94
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 98.93
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.92
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.91
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.9
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.9
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.9
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.87
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.87
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.86
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.86
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.84
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.8
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.8
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.79
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.76
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 98.76
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.76
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.74
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 98.74
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
Probab=100.00  E-value=6.6e-36  Score=338.27  Aligned_cols=295  Identities=15%  Similarity=0.202  Sum_probs=245.1

Q ss_pred             HhhhhccCCCCHHHHHHHHhhhhccCCCCCeEEccCCCCCCCCcHHHHHHHHHHHHc----cCCCCCchHHHHHHHHHHH
Q 043334          587 KSTEMIGFSRSAISVLNSAELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFAR----QNMSESEIDVTPSIQQYIK  662 (903)
Q Consensus       587 ~s~~~~~l~~s~i~~l~~a~~a~~~~~~~~~IdLs~g~p~~~~p~~v~~al~~al~~----y~~~~G~~~lr~ala~~l~  662 (903)
                      +++++..++.+.+..+...... ....++++|+|+.|+|++++|+.+.+++.+.+..    |....|.+++|+++++++.
T Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~i~l~~~~~~~~~~~~v~~a~~~~~~~~~~~y~~~~g~~~lr~~ia~~~~   82 (385)
T 1b5p_A            4 LSRRVQAMKPSATVAVNAKALE-LRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFR   82 (385)
T ss_dssp             CCHHHHHCCCCHHHHHHHHHHH-HHHTTCCCEECCCSSCSSCCCHHHHHHHHHHHHTTCCSCCCTTCCHHHHHHHHHHHH
T ss_pred             hhhHHhhcCcchHHHHHHHHHH-HHhcCCCEEEecCCCCCCCCCHHHHHHHHHHHhcCCCCCCCCCCCHHHHHHHHHHHH
Confidence            4566777888887766642111 1124678999999999998889999998887753    4445688999999999999


Q ss_pred             hhcCCCCCCCCcEEecCchHHHHHHHHHHhccCCCeEEEcCCCcHHHHHHHHHcCCEEEEecCCCCCCcccCHHHHHHHh
Q 043334          663 SNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTIL  742 (903)
Q Consensus       663 ~~~G~~~~pe~~I~vt~Gs~~al~~ll~~l~~pGD~Vlv~~P~y~~~~~~~~~~G~~vv~v~~~~~~~f~ld~~~L~~~l  742 (903)
                      +.+|++.+++ +|++|+|+++++..++.++++|||+|+++.|+|+.|...++..|++++.++++++++|.+|++++++++
T Consensus        83 ~~~g~~~~~~-~i~~t~g~~~al~~~~~~l~~~gd~Vlv~~p~y~~~~~~~~~~g~~~~~v~~~~~~~~~~d~~~l~~~l  161 (385)
T 1b5p_A           83 RENGLSVTPE-ETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAI  161 (385)
T ss_dssp             HTTCCCCCGG-GEEEESHHHHHHHHHHHHHCCTTCEEEEEESCCTHHHHHHHHTTCEEEEEECCGGGTTCCCHHHHHTTC
T ss_pred             HHhCCCCChH-HEEEcCChHHHHHHHHHHhcCCCCEEEEcCCCchhHHHHHHHcCCEEEEeecCcccCCCCCHHHHHHhc
Confidence            9899887777 999999999999999999999999999999999999999999999999999986567899999999998


Q ss_pred             hcCCCcEEEEECCCCCCcccCCCHHHHHHHHHHHHhCCcEEEEecCCCCCccCCCCCCCCchhhhhhhhccCCCCCCceE
Q 043334          743 ETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNVS  822 (903)
Q Consensus       743 ~~~~~~~vil~~P~~NPTG~v~s~eel~eI~~ia~k~~i~VI~DeaY~~l~f~~~~~s~~s~~~~~~~l~~~~~~~~~vI  822 (903)
                      ++++ ++|++++|+ ||||.++|.+++++|+++|+++|++||+||+|+++.|++ ..  .+    +..++.     ++++
T Consensus       162 ~~~~-~~v~~~~p~-NPtG~~~~~~~l~~i~~~~~~~~~~li~De~~~~~~~~~-~~--~~----~~~~~~-----~~~i  227 (385)
T 1b5p_A          162 TPRT-KALVVNSPN-NPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEG-EH--FS----PGRVAP-----EHTL  227 (385)
T ss_dssp             CTTE-EEEEEESSC-TTTCCCCCHHHHHHHHHHHHHTTCEEEEECTTTTCBSSS-CC--CC----GGGTCT-----TTEE
T ss_pred             CCCC-EEEEEeCCC-CCCCCCcCHHHHHHHHHHHHHcCCEEEEEccchhcccCC-CC--CC----HHHcCC-----CCEE
Confidence            7665 589999998 999999999999999999999999999999999988876 32  11    222221     4799


Q ss_pred             EEccCchhcccccceeeEEEeCcHHHHHHHHhCCC--CCCCcHHHHHHHHHHHhcccccchhHHHHHHHHHHHHHHHHHH
Q 043334          823 LLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPG--LSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSKR  900 (903)
Q Consensus       823 ~l~S~SK~~g~~GlRiG~lv~~~~~li~~l~~~~~--~~~~s~~~Q~aa~~~L~~~~~~~~~~~~~l~~~r~~y~~Rr~~  900 (903)
                      +++||||.||++|+|+||++++++ +++.+.....  ..+++.+.|.++..+|+  ..  +.-.++++++++.|+++++.
T Consensus       228 ~~~s~SK~~~~~G~RiG~~~~~~~-~~~~l~~~~~~~~~~~~~~~~~a~~~~l~--~~--~~~~~~~~~~~~~~~~~~~~  302 (385)
T 1b5p_A          228 TVNGAAKAFAMTGWRIGYACGPKE-VIKAMASVSRQSTTSPDTIAQWATLEALT--NQ--EASRAFVEMAREAYRRRRDL  302 (385)
T ss_dssp             EEEESTTTTTCGGGCCEEEECCHH-HHHHHHHHHHTTTCSCCHHHHHHHHHHHH--CH--HHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEechhhcCCcccceEEEEeCHH-HHHHHHHHHhhccCCCCHHHHHHHHHHHh--CC--CcchHHHHHHHHHHHHHHHH
Confidence            999999999999999999999887 9888877543  56788999999999994  20  00135788888899998887


Q ss_pred             Hh
Q 043334          901 LK  902 (903)
Q Consensus       901 l~  902 (903)
                      +.
T Consensus       303 l~  304 (385)
T 1b5p_A          303 LL  304 (385)
T ss_dssp             HH
T ss_pred             HH
Confidence            75
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 903
d1gdea_388 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 3e-11
d1b5pa_382 c.67.1.1 (A:) Aspartate aminotransferase, AAT {The 4e-11
d1oria_316 c.66.1.6 (A:) Protein arginine N-methyltransferase 7e-06
d2fyta1311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 3e-05
d1vl5a_231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 3e-05
d1g6q1_328 c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba 3e-05
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 9e-05
d1nw3a_328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 2e-04
d1iaya_428 c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate sy 4e-04
d1m7ya_431 c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate sy 4e-04
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 5e-04
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 0.002
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 0.002
d2gh1a1281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 0.002
d2h00a1250 c.66.1.54 (A:5-254) Methyltransferase 10 domain co 0.002
d2p7ia1225 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 0.003
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 0.003
d1ne2a_197 c.66.1.32 (A:) Hypothetical protein Ta1320 {Archae 0.004
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 0.004
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 388 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aromatic aminoacid aminotransferase, AroAT
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

 Score = 64.1 bits (155), Expect = 3e-11
 Identities = 33/188 (17%), Positives = 66/188 (35%), Gaps = 6/188 (3%)

Query: 616 GLIHMDVDQSFLPIPSLVKAAIFESFARQNMSESEIDVTPS----IQQYIKSNFGFPIDI 671
            +I + + +     P  +K    E+  +                 I + +K   G   D 
Sbjct: 26  DVISLGIGEPDFDTPQHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLKKQNGIEADP 85

Query: 672 NAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGF 731
             E +    +   F   +   + +G  +  P  +  +Y  A        V +PT  E  F
Sbjct: 86  KTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEF 145

Query: 732 KMTEKTLVTILETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSG 791
           ++    L   + T K   + I+ P  NPTG + + K++E I     ++   V+ D  +  
Sbjct: 146 RLNVDELKKYV-TDKTRALIINSPC-NPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEH 203

Query: 792 LEFNYEGW 799
             ++    
Sbjct: 204 FIYDDARH 211
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Length = 382 Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 428 Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Length = 431 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Length = 225 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 197 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query903
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 100.0
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 100.0
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 100.0
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 100.0
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 100.0
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 100.0
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 100.0
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 100.0
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 100.0
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 100.0
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 100.0
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 100.0
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 100.0
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 100.0
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 100.0
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 100.0
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 100.0
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 100.0
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 100.0
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 100.0
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.98
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.97
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.97
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.97
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.97
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.96
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.92
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.91
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.83
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.82
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.8
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.79
d2h00a1250 Methyltransferase 10 domain containing protein MET 99.78
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.69
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.63
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.62
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.6
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.59
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.58
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.58
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.58
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.57
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.55
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.53
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.53
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.52
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.5
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.48
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.45
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.44
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.44
d1mdoa_ 376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.44
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.43
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.42
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.42
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.42
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.4
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.4
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.4
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.4
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.4
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.39
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.39
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.38
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.38
d1gc0a_ 392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.38
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.37
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.36
d1y4ia1 397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.35
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.35
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.34
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.34
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.34
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.34
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.33
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.33
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.32
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.32
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.32
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.32
d1ibja_ 380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.32
d1c7ga_ 456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.32
d1cs1a_ 384 Cystathionine gamma-synthase, CGS {Escherichia col 99.31
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.31
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.3
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.3
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.3
d1b9ha_ 384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.3
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.29
d1qgna_ 398 Cystathionine gamma-synthase, CGS {Common tobacco 99.28
d1jf9a_ 405 NifS-like protein/selenocysteine lyase {Escherichi 99.27
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.26
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.25
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 99.25
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.24
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.23
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.22
d2ctza1 421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.21
d3bc8a1 445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.2
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.19
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.19
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.19
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.18
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.16
d1e5ea_ 394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.15
d1cl1a_ 391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.14
d1t3ia_ 408 Probable cysteine desulfurase SufS {Synechocystis 99.14
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.14
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.14
d1o69a_ 374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.14
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.13
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 99.13
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.12
d1pffa_ 331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.12
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.11
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.11
d1n8pa_ 393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.09
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.07
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.05
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 99.04
d2fnua1 371 Spore coat polysaccharide biosynthesis protein C { 99.04
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.0
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.99
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.98
d1ax4a_ 465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 98.96
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.93
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.92
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 98.91
d1h0ca_ 388 Alanine-glyoxylate aminotransferase {Human (Homo s 98.91
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.89
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.87
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.86
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.84
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 98.84
d2v1pa1 467 Tryptophan indol-lyase (tryptophanase) {Escherichi 98.82
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.81
d2bkwa1 382 Alanine-glyoxylate aminotransferase {Baker's yeast 98.76
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.76
d1qz9a_ 404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 98.76
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.73
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 98.71
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 98.69
d1kl1a_ 405 Serine hydroxymethyltransferase {Bacillus stearoth 98.68
d1pmma_ 450 Glutamate decarboxylase beta, GadB {Escherichia co 98.67
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.66
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.65
d1dfoa_ 416 Serine hydroxymethyltransferase {Escherichia coli 98.62
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.61
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 98.58
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 98.57
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.57
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 98.57
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.57
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.51
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 98.51
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.51
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 98.45
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.43
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.42
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.4
d2ch1a1 388 3-hydroxykynurenine transaminase {Malaria mosquito 98.38
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 98.38
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 98.37
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.36
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 98.35
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.34
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 98.32
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.28
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 98.27
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 98.27
d1rv3a_ 470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 98.26
d2a7va1 463 Serine hydroxymethyltransferase {Human (Homo sapie 98.26
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 98.26
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.22
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.22
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 98.09
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 98.07
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 97.93
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 97.9
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 97.76
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 97.74
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 97.73
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 97.65
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 97.65
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 97.5
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.49
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 97.48
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 97.47
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 97.42
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 97.4
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 97.31
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.3
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 97.21
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 97.19
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 97.19
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.18
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 96.97
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 96.96
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 96.94
d1k75a_431 L-histidinol dehydrogenase HisD {Escherichia coli 96.92
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 96.86
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 96.82
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 96.8
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 96.52
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.94
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.83
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.79
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.64
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.57
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 95.56
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 95.56
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 95.56
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 95.52
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 95.43
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 95.35
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 95.33
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 95.06
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 94.93
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.9
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 94.89
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 94.79
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 94.57
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.52
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.37
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.12
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 94.01
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 93.98
d1wyub1 471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 93.92
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 93.8
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 93.72
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 93.32
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 93.17
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.77
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 92.68
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 92.34
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 91.63
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 91.58
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 91.53
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 91.41
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.96
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 90.78
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 90.74
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 90.47
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 90.16
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 90.05
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 89.9
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 89.64
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 89.49
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 89.46
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 89.25
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 89.14
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 88.56
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 88.44
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 88.27
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 87.81
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 87.77
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 87.74
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 87.71
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 87.17
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 86.86
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 86.36
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 86.27
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 86.22
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 85.63
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 85.61
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 85.17
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 84.9
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 84.73
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 84.29
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 83.87
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 83.65
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 83.65
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 83.39
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 83.07
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 83.02
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 82.88
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 82.36
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 81.91
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 81.77
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 81.39
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 81.29
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 81.29
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 81.26
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 81.18
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 81.16
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 80.84
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 80.24
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=2.1e-42  Score=389.49  Aligned_cols=294  Identities=15%  Similarity=0.189  Sum_probs=257.7

Q ss_pred             HhhhhccCCCCHHHHHHH-HhhhhccCCCCCeEEccCCCCCCCCcHHHHHHHHHHHHc----cCCCCCchHHHHHHHHHH
Q 043334          587 KSTEMIGFSRSAISVLNS-AELSITETPNSGLIHMDVDQSFLPIPSLVKAAIFESFAR----QNMSESEIDVTPSIQQYI  661 (903)
Q Consensus       587 ~s~~~~~l~~s~i~~l~~-a~~a~~~~~~~~~IdLs~g~p~~~~p~~v~~al~~al~~----y~~~~G~~~lr~ala~~l  661 (903)
                      +|+|+..+++|++..+.+ ++.  ++..|.++|+|++|+|++++|+.+++++.+++.+    |.+..|.+++|+++++++
T Consensus         4 ~~~r~~~~~~s~~~~i~~~a~~--~~~~G~~vi~l~~g~p~~~~p~~i~~a~~~~~~~~~~~Y~~~~G~~~lR~~ia~~~   81 (382)
T d1b5pa_           4 LSRRVQAMKPSATVAVNAKALE--LRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKF   81 (382)
T ss_dssp             CCHHHHHCCCCHHHHHHHHHHH--HHHTTCCCEECCCSSCSSCCCHHHHHHHHHHHHTTCCSCCCTTCCHHHHHHHHHHH
T ss_pred             HHHHHHhCCCCHHHHHHHHHHH--HHhCCCCeEECCCCCCCCCCCHHHHHHHHHHHhcCCcCCCCCCCCHHHHHHHHhhh
Confidence            688999999999988875 322  2457889999999999999999999999998764    667889999999999999


Q ss_pred             HhhcCCCCCCCCcEEecCchHHHHHHHHHHhccCCCeEEEcCCCcHHHHHHHHHcCCEEEEecCCCCCCcccCHHHHHHH
Q 043334          662 KSNFGFPIDINAEFIYADCSQSLFNKLVLCCILEGGTLCFPAGSNGNYVSAARFLKANIVNIPTESEVGFKMTEKTLVTI  741 (903)
Q Consensus       662 ~~~~G~~~~pe~~I~vt~Gs~~al~~ll~~l~~pGD~Vlv~~P~y~~~~~~~~~~G~~vv~v~~~~~~~f~ld~~~L~~~  741 (903)
                      ++.+|...+++ +|++|+|+++++..++.+++++||.|++++|+|+.|...++..|++++.++++++++|.+|++.+++.
T Consensus        82 ~~~~~~~~~~~-~i~it~G~~~al~~~~~~l~~~gd~vl~~~P~y~~~~~~~~~~g~~~~~v~~~~~~~~~~d~~~l~~~  160 (382)
T d1b5pa_          82 RRENGLSVTPE-ETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRA  160 (382)
T ss_dssp             HHTTCCCCCGG-GEEEESHHHHHHHHHHHHHCCTTCEEEEEESCCTHHHHHHHHTTCEEEEEECCGGGTTCCCHHHHHTT
T ss_pred             hhhcccccccc-cceecCCHHHHHHHHHHHhCCCCCEEEECCCCcHHHHHHHHHhcCeEEEEecccccccCCCHHHHHHh
Confidence            99999998887 99999999999999999999999999999999999999999999999999998888899999999999


Q ss_pred             hhcCCCcEEEEECCCCCCcccCCCHHHHHHHHHHHHhCCcEEEEecCCCCCccCCCCCCCCchhhhhhhhccCCCCCCce
Q 043334          742 LETVKKPWVYISGPTINPTGLLYSNKEIENILTVCAKYGARVVIDTAFSGLEFNYEGWGGWDLEGCLSKLYSSTNSSFNV  821 (903)
Q Consensus       742 l~~~~~~~vil~~P~~NPTG~v~s~eel~eI~~ia~k~~i~VI~DeaY~~l~f~~~~~s~~s~~~~~~~l~~~~~~~~~v  821 (903)
                      +++++ ++++++||| ||||.++|.+++++|+++|+++|++||+||+|+++.|++...+      ....   .   .+++
T Consensus       161 ~~~~~-~~i~~~~P~-NPTG~~~s~~~~~~l~~~~~~~~~~ii~De~y~~~~~~~~~~~------~~~~---~---~~~~  226 (382)
T d1b5pa_         161 ITPRT-KALVVNSPN-NPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFS------PGRV---A---PEHT  226 (382)
T ss_dssp             CCTTE-EEEEEESSC-TTTCCCCCHHHHHHHHHHHHHTTCEEEEECTTTTCBSSSCCCC------GGGT---C---TTTE
T ss_pred             CCCCC-eEEEECCCC-CCcchhCCHHHHHHHHHHHHHcCeEEEEEccccceecCCCCCC------HHHc---C---CCCE
Confidence            88766 589999997 9999999999999999999999999999999999999887641      1111   1   1589


Q ss_pred             EEEccCchhcccccceeeEEEeCcHHHHHHHHhCCC--CCCCcHHHHHHHHHHHhcccccchhHHHHHHHHHHHHHHHHH
Q 043334          822 SLLGGLSLKMLTGALKFGFLVLNHPQLVDAFSSFPG--LSKPHSTVRYAIKKLLGLRERKARDLMNAVAEHIRNLESRSK  899 (903)
Q Consensus       822 I~l~S~SK~~g~~GlRiG~lv~~~~~li~~l~~~~~--~~~~s~~~Q~aa~~~L~~~~~~~~~~~~~l~~~r~~y~~Rr~  899 (903)
                      |+++||||+|++||||+||++++++ +++.+.++..  ..+++.+.|.++..++.  ..  .....++...++.|+.|++
T Consensus       227 i~~~s~SK~~~~~GlR~G~~~~~~~-~i~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~--~~~~~~~~~~~~~~~~~~~  301 (382)
T d1b5pa_         227 LTVNGAAKAFAMTGWRIGYACGPKE-VIKAMASVSRQSTTSPDTIAQWATLEALT--NQ--EASRAFVEMAREAYRRRRD  301 (382)
T ss_dssp             EEEEESTTTTTCGGGCCEEEECCHH-HHHHHHHHHHTTTCSCCHHHHHHHHHHHH--CH--HHHHHHHHHHHHHHHHHHH
T ss_pred             EEEecchhhccCcHhheEEEEECHH-HHHHHHHHHHhcccCcccccccccccccc--cc--cchhHHHHHHHHHHHhhhh
Confidence            9999999999999999999999988 8888876543  67788899988888884  22  2346788889999999998


Q ss_pred             HHh
Q 043334          900 RLK  902 (903)
Q Consensus       900 ~l~  902 (903)
                      .+.
T Consensus       302 ~~~  304 (382)
T d1b5pa_         302 LLL  304 (382)
T ss_dssp             HHH
T ss_pred             HHH
Confidence            764
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1k75a_ c.82.1.2 (A:) L-histidinol dehydrogenase HisD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure