Citrus Sinensis ID: 043341


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------76
QPAASLLPHHRHTRPATRRATTSSLQQPALVLLALVMTMEIKVLSFPADSPPLLVIAAAKLAGITIPTETSGSAPTFSFSNGSKLQGTYVLLRYIGRVGNFYGQNAYEAGEIDEWLDYTPVFSSGSEFENACTYVDKYLERRTFVVGHSLSIVDIAIWSALAGTGQRWDSLRKSKKYQNLVRWFNSLSAEYSDSLDEVTATYVSNRGLGKPTAAKSKEQQGVKGDVSEKGKAGSRPSFEVDLPDAEIGKVRLRFAPEPSGYLHIGHSKAALLNQYFAQRYQGQLIVRFDDTNPAKESNEFVDNLLKDIETLGIKYETVTYTSDYFPDLMEMAENLIRQGKAYVDDTPREQMQKERMDGIESKCRNNSIEENMKLWKEMIAGSERGLECCLRGKLDMQDPNKSLRDPVYYRCNPIPHHRIGSKYKVYPTYDFACPFVDAKEGITHALRSSEYHDRNAQYYRIQEDLGVRKVHIYEFSRLNMVYTLLSKRKLLWFVQNGKVDGWDDPRFPTVQGIVRRGLLVEALIQFILEQGASKNLNLMEWDKLWTINKKIIDPVCPRHTAVIEDRRVLLTLTDGPDKPFVRIIPRHKKYEGAGEKATTYTKRIWIDHADAQLISANEEITLMDWGNAIVKEISRDQDGNVTQLSGFLHLEGSVKNTKLKLTWLPETNELVNLTLVGFDYLITKKKLEEGEDFLDVLNPCTRFETAAIGDSNMRNLKRGEILQLERKGYFRCDVPFTRSSKPVVLFAIPDGRQQAVFK
cccccccccccccccccccHccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccccEEEEccccEECcHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccEEccccccHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHcHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHccccccccEEccccHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccCEEEEEEEcccccccccccccEEccccccccccccccccccccccccccccccccccHHHcccccccccHHHHHHHHHHcccccEEEEEEccccccEEEHHHHHHHHHHccccccccccccccHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccCEEEEEcccEEEEECcccccccEEEEccccccccccccEEEEccccEEEEcccccccccccEEEEccEEEEEEEEEEEcccccEEEEEEEECccccccccccEEEEcccccccEEEEEEEcccccccccccccccccccccccccEEEEEECccccccccccccEEEEEccEEEcccccccccccEEEEEccccccccccc
**********************SSLQQPALVLLALVMTMEIKVLSFPADSPPLLVIAAAKLAGITIPTETSGSAPTFSFSNGSKLQGTYVLLRYIGRVGNFYGQNAYEAGEIDEWLDYTPVFSSGSEFENACTYVDKYLERRTFVVGHSLSIVDIAIWSALAGTGQRWDSLRKSKKYQNLVRWFNSLSAEYSDSLDEVTATYV*********************************SFEVDLPDAEIGKVRLRFAPEPSGYLHIGHSKAALLNQYFAQRYQGQLIVRFDDTNPAKESNEFVDNLLKDIETLGIKYETVTYTSDYFPDLMEMAENLIRQGKAYVDDTPRE****************NSIEENMKLWKEMIAGSERGLECCLRGKLDMQDPNKSLRDPVYYRCNPIPHHRIGSKYKVYPTYDFACPFVDAKEGITHALRSSEYHDRNAQYYRIQEDLGVRKVHIYEFSRLNMVYTLLSKRKLLWFVQNGKVDGWDDPRFPTVQGIVRRGLLVEALIQFILEQGASKNLNLMEWDKLWTINKKIIDPVCPRHTAVIEDRRVLLTLTDGPDKPFVRIIPRHKKYEGAGEKATTYTKRIWIDHADAQLISANEEITLMDWGNAIVKEISRDQDGNVTQLSGFLHLEGSVKNTKLKLTWLPETNELVNLTLVGFDYLITKKKLEEGEDFLDVLNPCTRFETAAIGDSNMRNLKRGEILQLERKGYFRCDVPFTRSSKPVVLFAIP*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QPAASLLPHHRHTRPATRRATTSSLQQPALVLLALVMTMEIKVLSFPADSPPLLVIAAAKLAGITIPTETSGSAPTFSFSNGSKLQGTYVLLRYIGRVGNFYGQNAYEAGEIDEWLDYTPVFSSGSEFENACTYVDKYLERRTFVVGHSLSIVDIAIWSALAGTGQRWDSLRKSKKYQNLVRWFNSLSAEYSDSLDEVTATYVSNRGLGKPTAAKSKEQQGVKGDVSEKGKAGSRPSFEVDLPDAEIGKVRLRFAPEPSGYLHIGHSKAALLNQYFAQRYQGQLIVRFDDTNPAKESNEFVDNLLKDIETLGIKYETVTYTSDYFPDLMEMAENLIRQGKAYVDDTPREQMQKERMDGIESKCRNNSIEENMKLWKEMIAGSERGLECCLRGKLDMQDPNKSLRDPVYYRCNPIPHHRIGSKYKVYPTYDFACPFVDAKEGITHALRSSEYHDRNAQYYRIQEDLGVRKVHIYEFSRLNMVYTLLSKRKLLWFVQNGKVDGWDDPRFPTVQGIVRRGLLVEALIQFILEQGASKNLNLMEWDKLWTINKKIIDPVCPRHTAVIEDRRVLLTLTDGPDKPFVRIIPRHKKYEGAGEKATTYTKRIWIDHADAQLISANEEITLMDWGNAIVKEISRDQDGNVTQLSGFLHLEGSVKNTKLKLTWLPETNELVNLTLVGFDYLITKKKLEEGEDFLDVLNPCTRFETAAIGDSNMRNLKRGEILQLERKGYFRCDVPFTRSSKPVVLFAIPDGRQQAVFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable glutamate--tRNA ligase, cytoplasmic Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).probableO13775
Glutamate--tRNA ligase, cytoplasmic Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).probableP46655
Probable glutamate--tRNA ligase, cytoplasmic Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).probableQ54KB8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.1.-.-1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.probable
6.1.1.-Ligases forming aminoacyl-tRNA and related compounds.probable
6.1.1.17Glutamate--tRNA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AII, chain A
Confidence level:very confident
Coverage over the Query: 239-634,646-680,702-748
View the alignment between query and template
View the model in PyMOL
Template: 2HZ7, chain A
Confidence level:very confident
Coverage over the Query: 242-753
View the alignment between query and template
View the model in PyMOL
Template: 4EXJ, chain A
Confidence level:very confident
Coverage over the Query: 38-201
View the alignment between query and template
View the model in PyMOL