Citrus Sinensis ID: 043379

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MLNLKRVQLYRTIRVEEASNLIRSINSSSSAGLPISFTKMIFSLSNDVTARSAFGGRHKDRGEVFHLADMLPSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRACKAMGEAHALVNVLLDIEEHVDVQCPLTTDNIKA
cccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccccc
cccHHHHccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccEEHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccEEcccccccc
MLNLKRVQLYRTIRVEEASNLIRSinssssaglpisFTKMIFSLSNdvtarsafggrhkdrgevfhladmlpSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRACKAMGEAHALVNVLLDIEehvdvqcplttdnika
MLNLKRVQLYRTIRVEeasnlirsinssssaglPISFTKMIFSLSNDVTARSAFGGRHKDRGEVFHLADMLPSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRACKAMGEAHALVNVLLDIEEhvdvqcplttdnika
MLNLKRVQLYRTIRVEEAsnlirsinssssAGLPISFTKMIFSLSNDVTARSAFGGRHKDRGEVFHLADMLPSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRACKAMGEAHALVNVLLDIEEHVDVQCPLTTDNIKA
***********************************SFTKMIFSLSNDVTARSAFGGRHKDRGEVFHLADMLPSVKLLEML*************ADKIFANIINDHRACKAMGEAHALVNVLLDIEEHVDVQCPLT******
MLNLKRVQLYRTIRVEEASNLIRSINSSSSAGLPISFTKMIFSLSNDVTARSAFGGRHKDRGEVFHLADMLPSVKLLEMLSGMTSETKRMHEKADKIFANI*****************NVLLDIEEHVDVQCPLTTDNIKA
MLNLKRVQLYRTIRVEEASNLIRSINSSSSAGLPISFTKMIFSLSNDVTARSAFGGRHKDRGEVFHLADMLPSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRACKAMGEAHALVNVLLDIEEHVDVQCPLTTDNIKA
*LN*KRVQLYRTIRVEEASNLIRSINSSSSAGLPISFTKMIFSLSNDVTARSAFGGRHKDRGEVFHLADMLPSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRACK*MGEAHALVNVLLDIEEHVDVQCPLT******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNLKRVQLYRTIRVEEASNLIRSINSSSSAGLPISFTKMIFSLSNDVTARSAFGGRHKDRGEVFHLADMLPSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRACKAMGEAHALVNVLLDIEEHVDVQCPLTTDNIKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
A6YIH8 502 Premnaspirodiene oxygenas N/A no 0.985 0.276 0.343 8e-18
D5JBX1 496 Germacrene A oxidase OS=B N/A no 0.978 0.278 0.324 2e-17
O81974 504 Cytochrome P450 71D8 OS=G no no 0.985 0.275 0.351 2e-17
D5JBW8 488 Germacrene A oxidase OS=C N/A no 0.978 0.282 0.331 9e-17
D5J9U8 488 Germacrene A oxidase OS=L N/A no 0.978 0.282 0.324 1e-16
O22307 490 Cytochrome P450 71D11 (Fr N/A no 0.985 0.283 0.366 2e-16
D5JBW9 488 Germacrene A oxidase OS=S N/A no 0.978 0.282 0.311 8e-16
Q1PS23 495 Amorpha-4,11-diene 12-mon N/A no 0.978 0.278 0.311 2e-15
D5JBX0 488 Germacrene A oxidase OS=H N/A no 0.978 0.282 0.318 5e-15
P98183 495 Tabersonine 16-hydroxylas N/A no 0.985 0.280 0.341 1e-14
>sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 91/160 (56%), Gaps = 21/160 (13%)

Query: 1   MLNLKRVQLYRTIRVEEASNLIRSINSSSSAGLPISFTKMIFSLSNDVTARSAFGGRHKD 60
           +L+ K V+ + +IR +E   L+  + SS+S   P++FT+ +F  ++ +T RSAFG   K+
Sbjct: 136 VLSAKNVRSFSSIRRDEVLRLVNFVRSSTSE--PVNFTERLFLFTSSMTCRSAFGKVFKE 193

Query: 61  R-------GEV------FHLADMLPSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRA 107
           +        EV      F +AD+ PS+K L +L+GM  +  + H K D I  ++IN+H+ 
Sbjct: 194 QETFIQLIKEVIGLAGGFDVADIFPSLKFLHVLTGMEGKIMKAHHKVDAIVEDVINEHKK 253

Query: 108 CKAMGEAHA------LVNVLLDIEEHVDVQCPLTTDNIKA 141
             AMG+ +       L++VLL +     +Q P+T DNIKA
Sbjct: 254 NLAMGKTNGALGGEDLIDVLLRLMNDGGLQFPITNDNIKA 293
Involved in the biosynthesis of solavetivone, a potent antifungal phytoalexin. Catalyzes the successive and independent hydroxylations of premnaspirodiene and solavetivol. The first hydroxylation step is 3-fold more efficient than the second hydroxylation reaction.
Hyoscyamus muticus (taxid: 35626)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 1EC: 2EC: 1
>sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 Back     alignment and function description
>sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 Back     alignment and function description
>sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 Back     alignment and function description
>sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 Back     alignment and function description
>sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 Back     alignment and function description
>sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 Back     alignment and function description
>sp|Q1PS23|AMO_ARTAN Amorpha-4,11-diene 12-monooxygenase OS=Artemisia annua GN=CYP71AV1 PE=1 SV=1 Back     alignment and function description
>sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 Back     alignment and function description
>sp|P98183|C71DC_CATRO Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
359494299 505 PREDICTED: premnaspirodiene oxygenase-li 0.985 0.275 0.418 5e-24
224098836 384 cytochrome P450 [Populus trichocarpa] gi 0.985 0.361 0.426 2e-23
255544556 497 cytochrome P450, putative [Ricinus commu 0.985 0.279 0.387 2e-23
255563438 499 cytochrome P450, putative [Ricinus commu 0.985 0.278 0.4 4e-23
224096498 512 cytochrome P450 [Populus trichocarpa] gi 0.978 0.269 0.416 2e-22
224096502 509 cytochrome P450 [Populus trichocarpa] gi 0.978 0.271 0.409 5e-22
359494295 554 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.985 0.250 0.4 6e-22
255544562 533 cytochrome P450, putative [Ricinus commu 0.985 0.260 0.392 8e-22
255544544 501 cytochrome P450, putative [Ricinus commu 0.985 0.277 0.356 1e-21
224114037 490 cytochrome P450 [Populus trichocarpa] gi 0.978 0.281 0.413 4e-21
>gi|359494299|ref|XP_002264079.2| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 102/160 (63%), Gaps = 21/160 (13%)

Query: 1   MLNLKRVQLYRTIRVEEASNLIRSINSSSSAGLPISFTKMIFSLSNDVTARSAFGGRHKD 60
           +L+ KRVQ +R++R EE  NL+RSI  SS  G+ I+ T+ IFSL+  + +R+AFG + KD
Sbjct: 159 LLSAKRVQSFRSVREEEVLNLVRSI--SSQEGVSINLTESIFSLTFSIISRAAFGKKCKD 216

Query: 61  R-------------GEVFHLADMLPSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRA 107
           +             G  F +AD+ PS+KLL ++SG+  + +++H+K D I  NIIN+H+A
Sbjct: 217 QEAFSVTLEKFAGSGGGFTIADVFPSIKLLHVVSGIRHKLEKIHKKLDTILENIINEHKA 276

Query: 108 ---CKAMGEAHA---LVNVLLDIEEHVDVQCPLTTDNIKA 141
                 + EA     LV+VLL +++  D++ PLTTDNIKA
Sbjct: 277 RSEASEISEAEVDEDLVDVLLKVQKQGDLEFPLTTDNIKA 316

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224098836|ref|XP_002311285.1| cytochrome P450 [Populus trichocarpa] gi|222851105|gb|EEE88652.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255544556|ref|XP_002513339.1| cytochrome P450, putative [Ricinus communis] gi|223547247|gb|EEF48742.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255563438|ref|XP_002522721.1| cytochrome P450, putative [Ricinus communis] gi|223537959|gb|EEF39572.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224096498|ref|XP_002310634.1| cytochrome P450 [Populus trichocarpa] gi|222853537|gb|EEE91084.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224096502|ref|XP_002310636.1| cytochrome P450 [Populus trichocarpa] gi|222853539|gb|EEE91086.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359494295|ref|XP_003634756.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D10-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255544562|ref|XP_002513342.1| cytochrome P450, putative [Ricinus communis] gi|223547250|gb|EEF48745.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255544544|ref|XP_002513333.1| cytochrome P450, putative [Ricinus communis] gi|223547241|gb|EEF48736.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224114037|ref|XP_002332458.1| cytochrome P450 [Populus trichocarpa] gi|222832529|gb|EEE71006.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
UNIPROTKB|Q9XHE7 500 CYP71D13 "Cytochrome P450 71D1 0.992 0.28 0.288 1.9e-10
UNIPROTKB|Q9XHE6 498 CYP71D15 "Cytochrome P450 71D1 0.978 0.277 0.288 5e-10
UNIPROTKB|Q9XHE8 496 CYP71D18 "Cytochrome P450 71D1 0.971 0.276 0.296 1.3e-08
TAIR|locus:2119500 502 CYP83A1 ""cytochrome P450, fam 0.560 0.157 0.271 2.7e-07
TAIR|locus:2031820 504 CYP71B7 ""cytochrome P450, fam 0.510 0.142 0.285 3.7e-06
UNIPROTKB|Q0JF01 502 CYP99A3 "9-beta-pimara-7,15-di 0.971 0.272 0.237 5e-06
TAIR|locus:2169434 507 CYP93D1 ""cytochrome P450, fam 0.531 0.147 0.354 0.00016
TAIR|locus:504955640 490 CYP71A22 ""cytochrome P450, fa 0.964 0.277 0.238 0.0002
TAIR|locus:504955639 489 CYP71A26 ""cytochrome P450, fa 0.943 0.271 0.24 0.00032
TAIR|locus:2093531 501 CYP71B23 ""cytochrome P450, fa 0.539 0.151 0.240 0.00035
UNIPROTKB|Q9XHE7 CYP71D13 "Cytochrome P450 71D13" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
 Score = 156 (60.0 bits), Expect = 1.9e-10, P = 1.9e-10
 Identities = 45/156 (28%), Positives = 76/156 (48%)

Query:     1 MLNLKRVQLYRTIRVEEAXXXXXXXXXXXXAGLPISFTKMIFSLSNDVTARSAFGGRHKD 60
             +L+ + V+ +  IR +E             AG  +  T+ I +L+  +  R+AFG   +D
Sbjct:   139 LLSARNVRSFGFIRQDEVSRLLGHLRSSAAAGEAVDLTERIATLTCSIICRAAFGSVIRD 198

Query:    61 RGEV-------------FHLADMLPSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRA 107
               E+             F LADM PS KLL +L    S+  RM  + D I   I+ +H+ 
Sbjct:   199 HEELVELVKDALSMASGFELADMFPSSKLLNLLCWNKSKLWRMRRRVDAILEAIVEEHKL 258

Query:   108 CKAMGE--AHALVNVLLDIEEHVDVQCPLTTDNIKA 141
              K+ GE     +++VL  +++   ++ P+TT+ IKA
Sbjct:   259 KKS-GEFGGEDIIDVLFRMQKDSQIKVPITTNAIKA 293
GO:0018674 "(S)-limonene 3-monooxygenase activity" evidence=IDA
GO:0055114 "oxidation-reduction process" evidence=IDA
UNIPROTKB|Q9XHE6 CYP71D15 "Cytochrome P450 71D15" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XHE8 CYP71D18 "Cytochrome P450 71D18" [Mentha spicata (taxid:29719)] Back     alignment and assigned GO terms
TAIR|locus:2119500 CYP83A1 ""cytochrome P450, family 83, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031820 CYP71B7 ""cytochrome P450, family 71 subfamily B, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0JF01 CYP99A3 "9-beta-pimara-7,15-diene oxidase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2169434 CYP93D1 ""cytochrome P450, family 93, subfamily D, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955640 CYP71A22 ""cytochrome P450, family 71, subfamily A, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955639 CYP71A26 ""cytochrome P450, family 71, subfamily A, polypeptide 26"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093531 CYP71B23 ""cytochrome P450, family 71, subfamily B, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 9e-11
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 3e-08
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 9e-07
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-05
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 3e-05
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 6e-05
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information 
 Score = 57.8 bits (139), Expect = 9e-11
 Identities = 36/154 (23%), Positives = 71/154 (46%), Gaps = 18/154 (11%)

Query: 6   RVQLYRTIRVEEASNLIRSINSSSSAGLPISFTKMIFSLSNDVTARSAFGGRHKDRGEVF 65
           RV  ++ +R EEA  ++  IN ++     +  ++++ + +N V  R AFG ++ + GE  
Sbjct: 139 RVATFKHVREEEARRMMDKINKAADKSEVVDISELMLTFTNSVVCRQAFGKKYNEDGEEM 198

Query: 66  H-----------------LADMLPSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRAC 108
                              +D  P    L+ LSG+T+  K   E+ D     ++N+    
Sbjct: 199 KRFIKILYGTQSVLGKIFFSDFFPYCGFLDDLSGLTAYMKECFERQDTYIQEVVNETLDP 258

Query: 109 KAMG-EAHALVNVLLDIEEHVDVQCPLTTDNIKA 141
           K +  E  +++++L++I +        T DN+KA
Sbjct: 259 KRVKPETESMIDLLMEIYKEQPFASEFTVDNVKA 292

Length = 502
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.69
PLN03234 499 cytochrome P450 83B1; Provisional 99.54
PLN02966 502 cytochrome P450 83A1 99.43
PLN02687 517 flavonoid 3'-monooxygenase 99.4
PLN02971 543 tryptophan N-hydroxylase 99.35
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.34
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.33
PLN02290 516 cytokinin trans-hydroxylase 99.33
PLN03112 514 cytochrome P450 family protein; Provisional 99.32
PLN00168 519 Cytochrome P450; Provisional 99.31
PLN02183 516 ferulate 5-hydroxylase 99.21
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.2
PLN02655 466 ent-kaurene oxidase 99.14
PTZ00404 482 cytochrome P450; Provisional 99.14
PLN03018 534 homomethionine N-hydroxylase 99.1
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.07
PLN02394 503 trans-cinnamate 4-monooxygenase 99.05
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.03
PLN02738 633 carotene beta-ring hydroxylase 99.01
PLN02936 489 epsilon-ring hydroxylase 98.96
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 98.8
PLN02426 502 cytochrome P450, family 94, subfamily C protein 98.78
PLN02302 490 ent-kaurenoic acid oxidase 98.68
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.67
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 98.62
PLN02500 490 cytochrome P450 90B1 98.56
PLN02196 463 abscisic acid 8'-hydroxylase 98.46
PLN02774 463 brassinosteroid-6-oxidase 98.42
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 98.31
PLN02987 472 Cytochrome P450, family 90, subfamily A 98.04
PLN02648 480 allene oxide synthase 97.68
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 97.4
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.69  E-value=7.3e-16  Score=107.57  Aligned_cols=138  Identities=27%  Similarity=0.513  Sum_probs=107.2

Q ss_pred             CCCHHHHHHhHHHHHHHHHHHHHHHHhhcCCCCcccHHHHHHHHHHHHHHHHHHcCCcCCCC-c----------------
Q 043379            1 MLNLKRVQLYRTIRVEEASNLIRSINSSSSAGLPISFTKMIFSLSNDVTARSAFGGRHKDRG-E----------------   63 (141)
Q Consensus         1 ~fs~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~~~d~~~~~~~~~~~vi~~~~fG~~~~~~~-~----------------   63 (141)
                      +|+.++++++.....++++.+++.+.+ ...+.++|+...+..++.|||++++||.+++.++ +                
T Consensus       132 L~~~~~~~~~~~~R~~E~~~l~~~l~~-~~~~~~vdl~~~l~~~~~nvI~~~~fG~rf~~~~~~~~~~~~~l~~~~~~~~  210 (489)
T KOG0156|consen  132 LRSFGRGKSFMEIREEEVDELVKKLSK-SKKGEPVDLSELLDLLVGNVICRMLFGRRFEEEDEEEFLELKELVEESLELL  210 (489)
T ss_pred             hcChhhhhhhHHHHHHHHHHHHHHHHh-cCCCceeeHHHHHHHHHHHHHHHHHhCCccccCCchHHHHHHHHHHHHHHHh
Confidence            588899999999999999999999987 2223799999999999999999999999999742 1                


Q ss_pred             -ccccCccch-hhhhchhhhCchHHHHHHHHHHHHHHHHHHHHHHHhhhcCCcccHHHHHHhchhccCCCCccCccccc
Q 043379           64 -VFHLADMLP-SVKLLEMLSGMTSETKRMHEKADKIFANIINDHRACKAMGEAHALVNVLLDIEEHVDVQCPLTTDNIK  140 (141)
Q Consensus        64 -~~~~~~~~p-~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~~~~i~  140 (141)
                       .+.+.+++| ++.++++..+..+........+..++.++|++|+++...++..||+|.||..+++++.+ .+|+++|+
T Consensus       211 ~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~~~~~~~D~vD~lL~~~~~~~~~-~~t~~~i~  288 (489)
T KOG0156|consen  211 GSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHREKIGDEEGRDFVDALLKLMKEEKAE-GLTDDHLK  288 (489)
T ss_pred             CCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCcHHHHHHHhhcccccC-CCCHHHHH
Confidence             345678889 67776323455566677777799999999999987641122379999999987654311 28888875

>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 9e-15
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-09
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 8e-06
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-05
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 3e-04
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score = 68.9 bits (169), Expect = 9e-15
 Identities = 18/167 (10%), Positives = 49/167 (29%), Gaps = 32/167 (19%)

Query: 1   MLNLKRVQLYRTIRVEEASNLIRSI----NSSSSAGLPISFTKMIFSLSNDVTARSAFGG 56
           ++  +  + +  +    + + +  +      + S       +  +F  + +      FG 
Sbjct: 118 VMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGE 177

Query: 57  RHKDRGEV-------------------FHLADMLPSV-KLLEM--LSGMTSETKRMHEKA 94
           R     EV                     + ++ P + +L          +    +  KA
Sbjct: 178 RQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKA 237

Query: 95  DKIFANIINDHRACKAMGEAHALVNVLLDIEEHVDVQCPLTTDNIKA 141
           D    N   + R   ++        +L  +         ++ ++IKA
Sbjct: 238 DIYTQNFYWELRQKGSVHH--DYRGILYRLLGDSK----MSFEDIKA 278
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.39
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.36
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.35
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.33
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.3
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.3
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.28
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.27
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.26
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.25
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.25
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.23
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.21
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.21
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.14
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.14
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.1
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.08
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.07
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.01
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 98.99
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 98.99
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 98.96
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.92
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 98.91
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 98.88
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 98.86
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 98.77
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 98.72
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 98.72
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 98.72
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 98.7
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.7
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 98.66
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 98.66
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 98.65
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 98.65
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 98.64
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 98.63
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 98.62
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 98.61
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 98.61
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 98.59
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 98.58
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 98.57
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 98.53
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 98.52
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 98.5
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 98.5
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 98.5
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 98.49
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 98.47
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 98.43
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 98.37
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 98.35
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 98.34
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 98.33
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 98.33
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 98.28
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 98.26
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 98.21
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 98.12
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 98.08
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 98.08
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 98.04
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 98.02
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 97.97
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 97.8
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 97.64
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 97.62
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 97.61
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 97.43
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 97.38
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 97.3
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 97.25
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 96.93
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
Probab=99.39  E-value=5.1e-12  Score=88.03  Aligned_cols=133  Identities=14%  Similarity=0.187  Sum_probs=95.2

Q ss_pred             HHhHHHHHHHHHHHHHHHHhhcCCCCcccHHHHHHHHHHHHHHHHHHcCCcCCCCc-----------------ccccCcc
Q 043379            8 QLYRTIRVEEASNLIRSINSSSSAGLPISFTKMIFSLSNDVTARSAFGGRHKDRGE-----------------VFHLADM   70 (141)
Q Consensus         8 ~~~~~~~~~~~~~l~~~l~~~~~~~~~~d~~~~~~~~~~~vi~~~~fG~~~~~~~~-----------------~~~~~~~   70 (141)
                      +.+.+.+.++++.+++.+.+....+.++|+...+..+++|+++.++||.+++..++                 ...+.++
T Consensus       124 ~~~~~~i~~~~~~l~~~l~~~~~~~~~vd~~~~~~~~~~dvi~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  203 (507)
T 3pm0_A          124 QVLEGHVLSEARELVALLVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDV  203 (507)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTGGGCCBCCHHHHHHHHHHHHHHHHTSCCCCTTCHHHHHHTSCHHHHHHHHSTTCCTTT
T ss_pred             HHHHHHHHHHHHHHHHHHHhhcccCCCcChHHHHHHHHHHHHHHHHccccCCCCCHHHHHHHHHHHHHHHhcccchHHHH
Confidence            45889999999999999986544467899999999999999999999999876431                 1234456


Q ss_pred             chhhhhch-hhhCchHHHHHHHHHHHHHHHHHHHHHHHhhhc-CCcccHHHHHHhchhccCC------CCccCccccc
Q 043379           71 LPSVKLLE-MLSGMTSETKRMHEKADKIFANIINDHRACKAM-GEAHALVNVLLDIEEHVDV------QCPLTTDNIK  140 (141)
Q Consensus        71 ~p~l~~l~-~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~-~~~~d~l~~ll~~~~~~~~------~~~~~~~~i~  140 (141)
                      +||++++. +..+..+......+.+..++.++++++++.... ....|+++.+++.......      +..+++++|.
T Consensus       204 ~P~l~~lp~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~~~~~l~~~~i~  281 (507)
T 3pm0_A          204 MPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSAEKKAAGDSHGGGARLDLENVP  281 (507)
T ss_dssp             CGGGGGSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCTTCCCCSHHHHHHHHHHHHHSCC----CCCCCGGGHH
T ss_pred             hHHHHHcCchhHHHHHHHHHHHHHHHHHHHHHHHHHHhccccccCCccHHHHHHHHhhhhccccccCCCCCCCHHHHH
Confidence            78877662 111123455666778888899999888876543 3468999999965432110      1248888764
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.32
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.2
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 98.62
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 98.5
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 98.25
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 98.11
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 98.06
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 97.95
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 97.88
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 97.81
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 97.62
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 97.48
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 97.36
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 97.24
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 97.19
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 96.97
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 96.36
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 95.83
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 95.54
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 93.43
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=99.32  E-value=9.9e-12  Score=83.86  Aligned_cols=132  Identities=17%  Similarity=0.224  Sum_probs=92.0

Q ss_pred             CCHHHHHHhHHHHHHHHHHHHHHHHhhcCCCCcccHHHHHHHHHHHHHHHHHHcCCcCCC--Cc---------------c
Q 043379            2 LNLKRVQLYRTIRVEEASNLIRSINSSSSAGLPISFTKMIFSLSNDVTARSAFGGRHKDR--GE---------------V   64 (141)
Q Consensus         2 fs~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~~~d~~~~~~~~~~~vi~~~~fG~~~~~~--~~---------------~   64 (141)
                      |++++++.+.+.+.++++.+++.|.+. ..+.++|+..++..+++|+++.++||.+++..  ++               .
T Consensus       105 fs~~~l~~~~~~i~~~~~~li~~l~~~-~~~~~idl~~~~~~~~~~~i~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~  183 (453)
T d2ij2a1         105 FSQQAMKGYHAMMVDIAVQLVQKWERL-NADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAM  183 (453)
T ss_dssp             GSTTTHHHHHHHHHHHHHHHHHHHHTC-CTTCCEEHHHHHHHHHHHHHHHHHHSCCCCGGGCSSCCHHHHHHHHHHHHHH
T ss_pred             hhhhhhhhhhhhHHHHHHHHHHHhhhc-CCCCccchHHHHHHHhhhcchhcccccccchhhhccchHHHHhhhhccchhh
Confidence            778899999999999999999999753 34678999999999999999999999998642  11               0


Q ss_pred             cccCccchhhhhchhhhCchHHHHHHHHHHHHHHHHHHHHHHHhhhcCCcccHHHHHHhchhccCCCCccCccccc
Q 043379           65 FHLADMLPSVKLLEMLSGMTSETKRMHEKADKIFANIINDHRACKAMGEAHALVNVLLDIEEHVDVQCPLTTDNIK  140 (141)
Q Consensus        65 ~~~~~~~p~l~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~~~~i~  140 (141)
                      ..+....|++..+   ....+...+..+.++.++..+++++++..  +...|+++.+++...+.. +..+++++|.
T Consensus       184 ~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~i~~r~~~~--~~~~d~l~~ll~~~~~~~-~~~ls~~ei~  253 (453)
T d2ij2a1         184 NKLQRANPDDPAY---DENKRQFQEDIKVMNDLVDKIIADRKASG--EQSDDLLTHMLNGKDPET-GEPLDDENIR  253 (453)
T ss_dssp             HTC---CTTSGGG---HHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCSSHHHHHHHCCCTTT-CCCCCHHHHH
T ss_pred             hhhhhcccccccc---hhhHHHHHHHHHHHHHHHHHHHhhhcccc--ccccchhhhhhhhccccc-CcchhhhHHH
Confidence            0111122222111   11234455666778888888888776542  356799999998765432 2468887764
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure