Citrus Sinensis ID: 043436


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
ANFWASVKLEPSDDLVIKPHPVHDLVQFQSLHHLMNRLQNEGYYGGVRLVMAICKVFFKYCKDNKIDLHKGNFTLSYDTNIPRQTGLSGSSAIVCAALDCLLDFYKVRHLVKVEIRPNLILNAEKELGIVAGLQDRVAQVYGGLVHMDFRKEHMDELGHGIYKPMDIDLLPPLYLIYAENPSDSGKVHSTVRQRWLDGDEFIISSMKEVAQMAAEGQAAILEKNYSKLAELMNHNFDLRRRMFGDDVLGALNIEMVEIARRFGAASKFTGSGGAVIAFCPNGPSQVELLEDACRKAGFSIEP
cccEEEEEEECcccEEEECcccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEECcccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHcccEEEEEcccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccEEEEECccccHHHHHHHHHHHccccccc
*NFWASVKLEPSDDLVIKPHPVHDLVQFQSLHHLMNRLQNEGYYGGVRLVMAICKVFFKYCKDNKIDLHKGNFTLSYDTNIPRQTGLSGSSAIVCAALDCLLDFYKVRHLVKVEIRPNLILNAEKELGIVAGLQDRVAQVYGGLVHMDFRKEHMDELGHGIYKPMDIDLLPPLYLIYAENPSDSGKVHSTVRQRWLDGDEFIISSMKEVAQMAAEGQAAILEKNYSKLAELMNHNFDLRRRMFGDDVLGALNIEMVEIARRFGAASKFTGSGGAVIAFCPNGPSQVELLEDACRKAGFSIEP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ANFWASVKLEPSDDLVIKPHPVHDLVQFQSLHHLMNRLQNEGYYGGVRLVMAICKVFFKYCKDNKIDLHKGNFTLSYDTNIPRQTGLSGSSAIVCAALDCLLDFYKVRHLVKVEIRPNLILNAEKELGIVAGLQDRVAQVYGGLVHMDFRKEHMDELGHGIYKPMDIDLLPPLYLIYAENPSDSGKVHSTVRQRWLDGDEFIISSMKEVAQMAAEGQAAILEKNYSKLAELMNHNFDLRRRMFGDDVLGALNIEMVEIARRFGAASKFTGSGGAVIAFCPNGPSQVELLEDACRKAGFSIEP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucuronokinase 1 Sugar-1-kinase with a strict substrate specificity for D-glucuronic acid and ATP. Involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers. May be also involved in a salvage pathway for glucuronic acid.confidentQ93ZC9
Probable glucuronokinase 2 Sugar-1-kinase with a strict substrate specificity for D-glucuronic acid and ATP. Involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers. May be also involved in a salvage pathway for glucuronic acid.probableQ9LY82

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K17, chain A
Confidence level:very confident
Coverage over the Query: 2-302
View the alignment between query and template
View the model in PyMOL