Citrus Sinensis ID: 043471

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-----
MGTQSNHGEREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRFTGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDMMFSNWLLMYLSDKEVEKLAERMVKWLKVGGYIFFRESCFHQSGDSKRKHNPTHYREPRFYSKVFKECQIQDASGNSFELSLVGYKCIGAYVKNKKNQNQICWIWQKVRSQNDRGFQQFLDNVQYKLNGILRYERVFGVGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMADKFDVHVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKTYPENSFDVIYSRDTILHIQDKPALFKSFFKWLKPGGTVLISDYCKSFGTPSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDIIAEDRTEQFVQVLQRELDAIEKDKDAFIKDFSEVFCFFHLDCLSDTVDSSLFSVLKCF
ccccccHHHHHHHHHHHccccccccHHHHHccccccccccccHHHHHHccccccccEEEEEcccccHHHHHHHHHcccEEEEEccHHHHHHHHHHccccccEEEEEEEccccccccccccEEEEEHHHHHHccccHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccHHHHccccccccccccccccccccccHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHccccHHccccccccccccccHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHcccEEEEEEccHHHHHHHHHHHccccccEEEEEccccccccccccccEEEEcccccccccHHHHHHHHHHHccccCEEEEEEcccccccccHHHHHHHHHcccccccHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
***********IQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRFTGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDMMFSNWLLMYLSDKEVEKLAERMVKWLKVGGYIFFRESCFHQSGDSKRKHNPTHYREPRFYSKVFKECQIQDASGNSFELSLVGYKCIGAYVKNKKNQNQICWIWQKVRSQNDRGFQQFLDNVQYKLNGILRYERVFGVGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMADKFDVHVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKTYPENSFDVIYSRDTILHIQDKPALFKSFFKWLKPGGTVLISDYCKSFGTPSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDIIAEDRTEQFVQVLQRELDAIEKDKDAFIKDFSEVFCFFHLDCLSDTVDSSLFSVLKCF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTQSNHGEREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRFTGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDMMFSNWLLMYLSDKEVEKLAERMVKWLKVGGYIFFRESCFHQSGDSKRKHNPTHYREPRFYSKVFKECQIQDASGNSFELSLVGYKCIGAYVKNKKNQNQICWIWQKVRSQNDRGFQQFLDNVQYKLNGILRYERVFGVGFVSTGGIETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMADKFDVHVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKTYPENSFDVIYSRDTILHIQDKPALFKSFFKWLKPGGTVLISDYCKSFGTPSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDIIAEDRTEQFxxxxxxxxxxxxxxxxxxxxxFSEVFCFFHLDCLSDTVDSSLFSVLKCF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphoethanolamine N-methyltransferase 1 Catalyzes N-methylation of phosphoethanolamine, phosphomonomethylethanolamine and phosphodimethylethanolamine, the three methylation steps required to convert phosphoethanolamine to phosphocholine.confidentQ9FR44
Phosphoethanolamine N-methyltransferase Catalyzes N-methylation of phosphoethanolamine, phosphomonomethylethanolamine and phosphodimethylethanolamine, the three methylation steps required to convert phosphoethanolamine to phosphocholine. Mediates a key step in the biosynthesis of choline, a precursor of the osmoprotectant glycine betaine. Has no ethanolamine- or phosphatidylethanolamine-N-methyltransferase activity.probableQ9M571
Phosphoethanolamine N-methyltransferase 3 Catalyzes N-methylation of phosphoethanolamine, phosphomonomethylethanolamine and phosphodimethylethanolamine, the three methylation steps required to convert phosphoethanolamine to phosphocholine.probableQ9C6B9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.103Phosphoethanolamine N-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UJC, chain A
Confidence level:very confident
Coverage over the Query: 237-448
View the alignment between query and template
View the model in PyMOL
Template: 1XTP, chain A
Confidence level:very confident
Coverage over the Query: 11-194
View the alignment between query and template
View the model in PyMOL
Template: 3DMG, chain A
Confidence level:confident
Coverage over the Query: 39-163,179-220,233-432
View the alignment between query and template
View the model in PyMOL