Citrus Sinensis ID: 043512

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------

MRTLSILILLIFSPQPTFQQEPTVCIIGSGIGGSSLAHFLRQYSSKNWHPRILMFERNGVVGGRMATVTISGQTFEAGASILHPKNYHTVNFTKLLNLKPKDPPSSEDSTAFGIWDGSKFVFKTISVSSTVPFVQKIVSLANSVLMVLRYGLSLLRMESFTESAVDKFLKYYESFETRPVFESVDEMLKWAGLFNLTARSLEEELIDARLSPLLMQELVTIITRINYGQSLSISGLAGAVSLAGSGGGLWAVEGGNWQMAAGLINRSDVALHLHEEIESISYLREYYELNSTKGNSYTCQITVVATPLDELNLHFSPPISIPERKLQHTHATFVRGALNPAYFGLDGVSKIPELVATIEDPDLPFTCISVLKQHDENDFTYKIFSRKPMTDTLLDDIFSVRKETIRINWGAYPHYKAPEVFAPFILDGRHLYYVNAFENAASTMETSAVAAENVARLILSRFFSKPSVTSLNLKTSSDAREELHLDL

ccHHHHHHHHHccccccccccccEEEEcccHHHHHHHHHHHHccccccccEEEEEcccccccccEEEEEEccCEECcccEEEEcccHHHHHHHHHccccccccccccccccEEEEcccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccEEECcccHHHHHHHHHHcccEEEEcccEEEEEEEccEEEEEcccccCEEccEEEEccccccccccccccccccccccEEEEEEEEcccccccccccccccccccEEEEcccccccEEEEEccccccccccEEEEcccccccHHHHHHHccccccEEEEECcccccccccccccccEECcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHcccc

*RTLSILILLIFSPQPTFQQEPTVCIIGSGIGGSSLAHFLRQYSSKNWHPRILMFERNGVVGGRMATVTISGQTFEAGASILHPKNYHTVNFTKLLNLKPKD*PSSEDSTAFGIWDGSKFVFKTISVSSTVPFVQKIVSLANSVLMVLRYGLSLLRMESFTESAVDKFLKYYESFETRPVFESVDEMLKWAGLFNLTARSLEEELIDARLSPLLMQELVTIITRINYGQSLSISGLAGAVSLAGSGGGLWAVEGGNWQMAAGLINRSDVALHLHEEIESISYLREYYELNSTKGNSYTCQITVVATPLDELNLHFSPPISIPERKLQHTHATFVRGALNPAYFGLDGVSKIPELVATIEDPDLPFTCISVLKQHDENDFTYKIFSRKPMTDTLLDDIFSVRKETIRINWGAYPHYKAPEVFAPFILDGRHLYYVNAFENAASTMETSAVAAENVARLILSRFFS***********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Farnesylcysteine lyase	Involved in the degradation of prenylcysteine. Cleaves specifically the thioether bond of S-farnesyl-L-cysteine and has no activity with S-geranylgeranyl-L-cysteine. Recognizes also N-acetyl-farnesylcysteine and may have a role in deprenylation of farnesylated proteins.	probable	P57681
Prenylcysteine oxidase-like	Probable oxidoreductase.	probable	Q8C7K6
Prenylcysteine oxidase 1	Involved in the degradation of prenylated proteins. Cleaves the thioether bond of prenyl-L-cysteines, such as farnesylcysteine and geranylgeranylcysteine.	probable	Q9UHG3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DGK, chain A
Confidence level:confident
Coverage over the Query: 21-307,329-348,360-373,405-465
View the alignment between query and template
View the model in PyMOL

Template: 3NRN, chain A
Confidence level:confident
Coverage over the Query: 42-124,136-141,159,183-409,421-458
View the alignment between query and template
View the model in PyMOL

Template: 3UTF, chain A
Confidence level:probable
Coverage over the Query: 24-372
View the alignment between query and template
View the model in PyMOL