Citrus Sinensis ID: 043551


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MENGAVKSGGRGGDMEAVLVPACIINKRRRRERDPSLGIGFNNVNQQVEQQADQAAAATTAAAATTVKRSSKYRGVSRHRWTGRYEAHLWDKGSWNPTQRKKGKQGAYDEEESAARAYDLAALKYWGTSTFTNFPVSEYEKEIEIMKTVTREEYLATLRRRSSGFSRGVSKHHHNRRWEARIGRVFGNKYLYLGTYGTQEEAAHAYDIAAIEHRGINAVTNFDISTYIRWLKPAAGGNSHNPAFQEPKPILEYSPPTSSLLSNHILTEGHQITDISIFNDSNPFPLQDQDIPKKQDSFQANIKSSLPFSPCTKSSSSSPTALSLLLRSSVFKELVEKNPNNSAEVNIEENDTKNGPKIGSKNEVEETLYDEFVINNPVQYICPSSKICVSFLSSGRTEALDFNCSMAL
cccccccccccccccHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccccEEEEEEccccccccccCEEECcccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcHHHHHHHHHcccccccccccccccccccccccccccccCEEEccccccHHHHHHHHHHHHHHHccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHccccccccccccccccccccccccccccHHHccccccccccccccccccHHHHcccccccccccccccccc
****************AVLVPACIIN**************************************************SRHRWTGRYEAHLWDKGSWNPTQRKKGKQGAYDEEESAARAYDLAALKYWGTSTFTNFPVSEYEKEIEIMKTVTREEYLATLRRRSS************RRWEARIGRVFGNKYLYLGTYGTQEEAAHAYDIAAIEHRGINAVTNFDISTYIRWLKPA***********************************************************************************************************************************ETLYDEFVINNPVQYICPSSKICVSFLSSGRTEALDFNCSMAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENGAVKSGGRGGDMEAVLVPACIINKRRRRERDPSLGIGFNNVNQQVEQQADQAAAATTAAAATTVKRSSKYRGVSRHRWTGRYEAHLWDKGSWNPTQRKKGKQGAYDEEESAARAYDLAALKYWGTSTFTNFPVSEYEKEIEIMKTVTREEYLATLRRRSSGFSRGVSKHHHNRRWEARIGRVFGNKYLYLGTYGTQEEAAHAYDIAAIEHRGINAVTNFDISTYIRWLKPAAGGNSHNPAFQEPKPILEYSPPTSSLLSNHILTEGHQITDISIFNDSNPFPLQDQDIPKKQDSFQANIKSSLPFSPCTKSSSSSPTALSLLLRSSVFKELVEKNPNNSAEVNIEENDTKNGPKIGSKNEVEETLYDEFVINNPVQYICPSSKICVSFLSSGRTEALDFNCSMAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ethylene-responsive transcription factor WRI1 May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). Transcriptional activator involved in the activation of a subset of sugar-responsive genes and the control of carbon flow from sucrose import to oil accumulation in developing seeds. Binds to the GCC-box pathogenesis-related promoter element. Promotes sugar uptake and seed oil accumulation by glycolysis. Required for embryo development, seed germination and, indirectly, for seedling establishment. Negative regulator of the ABA-mediated germination inhibition.probableQ6X5Y6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 72-137
View the alignment between query and template
View the model in PyMOL
Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 165-225
View the alignment between query and template
View the model in PyMOL
Template: 1U3E, chain M
Confidence level:probable
Coverage over the Query: 140-207
View the alignment between query and template
View the model in PyMOL