Citrus Sinensis ID: 043713


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
VPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIPLPPEEEKELKETLQETLGQGKKVKVEQKVDPSILGGLVVEFGQKVFDMSIKSRARQMERFLREPIHFGTL
ccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccEEEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEEEccccccEEEEEEccEEEHHHHHHHHHHHHHHHHcHcccccc
VPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIPLPPEEEKELKETLQETLGQGKKVKVEQKVDPSILGGLVVEFGQKVFDMSIKSRARQMERFLREPIHFG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIPLPPEEEKELKETLQETLGQGKKVKVEQKVDPSILGGLVVEFGQKVFDMSIKSRARQMERFLREPIHFGTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP synthase subunit delta This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction.probableA9WWS5
ATP synthase subunit delta This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction.probableA5V3X2
ATP synthase subunit O, mitochondrial Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.probableQ06647

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSS, chain S
Confidence level:very confident
Coverage over the Query: 1-141,164-184
View the alignment between query and template
View the model in PyMOL