Citrus Sinensis ID: 043762

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---

MKDYIFGYSFLNPCLKSPYFSLLHVLLIQIQLAFSSPDVLILPLRTQEIPSGSFPRSPNKLPFHHNVSLTVSLTVGTPPQNVSMVLDTGSELSWLHCNNTRYSYPNAFDPNLSSSYKPVTCSSPTCVNRTRDFTIPVSCDNNSLCHATLSYADASSSEGNLASDQFFIGSSEISGLVFGCMDSVFSSSSDEDGKNTGLMGMNRGSLSFVSQMGFPKFSYCISGADFSGLLLLGDADLPWLLPLNYTPLIQMTTPLPYFDRVAYTVQLEGIKVLDKLLPIPRSVFVPDHTGAGQTMVDSGTQFTFLLGPAYAALRTEFLNQTASILKVLEDQNFVFQGAMDLCYRVPQNQSRLPQLPAVSLVFRGAEMSVSGDRLLYRAPGEVRGIDSVYCFTFGNSDLLGVEAYVIGHHHQQNVWMEFDLERSRIGMAQVRCDLAGQRFGVGL

cccEEEEEEEEccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEEcccccCEEEEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccCEEEEEEEEEEEEcccccccEEEccccccccccccccccccEEEEcccccccHHHccccccEEEcccccccccEEEEcccccccccccEEEccccccccccccccccEEEEEEEEEEccEEEccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEcccEEECccccEEEEccccccccccEEEEEEECccccccccEEEEcEEEEEEEEEEEccccEEEEEcccccHHHHHccccc

***YIFGYSFLNPCLKSPYFSLLHVLLIQIQLAFSSPDVLILPLRTQ**************PFHHNVSLTVSLTVGTPPQNVSMVLDTGSELSWLHCNNTRYSYPNAFDPNLSSSYKPVTCSSPTCVNRTRDFTIPVSCDNNSLCHATLSYADASSSEGNLASDQFFIGSSEISGLVFGCMDSVFSSSSDEDGKNTGLMGMNRGSLSFVSQMGFPKFSYCISGADFSGLLLLGDADLPWLLPLNYTPLIQMTTPLPYFDRVAYTVQLEGIKVLDKLLPIPRSVFVPDHTGAGQTMVDSGTQFTFLLGPAYAALRTEFLNQTASILKVLEDQNFVFQGAMDLCYRVPQNQSRLPQLPAVSLVFRGAEMSVSGDRLLYRAPGEVRGIDSVYCFTFGNSDLLGVEAYVIGHHHQQNVWMEFDLERSRIGMAQVRCDLAGQRFGV**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Aspartic proteinase PCS1	Embryo-specific aspartic protease that limits programmed cell death during reproductive development. Possesses peptidase activity toward casein in vitro.	probable	Q9LZL3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VLA, chain A
Confidence level:very confident
Coverage over the Query: 37-48,65-100,111-431
View the alignment between query and template
View the model in PyMOL

Template: 3LPJ, chain A
Confidence level:very confident
Coverage over the Query: 60-120,145-436
View the alignment between query and template
View the model in PyMOL