Citrus Sinensis ID: 043831

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MGPRWKGRASEAKSSGRSHVQNHLRFTFLSIQSEAHAVLAGYSALLAVEAEQTELLNRACFGRHIVTAEKDKQWYQLGMEEGFYLCHSLKCLKIVGEDNSTKNDDELWQYMKAKKETFPLLYKAYSHLRKKNWVVRSGSQYGVDFVAYRHHPSLVHSEYAVLVLAEGEDGENGRLRVWSDIHCTVRLCGGVAKTLLILTINKNGQGTATPSCLEQYAVEERTISRWSPEQCREDPATVANGIK
cccccccccccccccccccccccccccccccccccEEEEEccEEEEEccHHHHHHHHHccccccccccccccccccccHHHHHHHHHccccEEEEccccccccHHHHHHHHHHcccccHHHHHHHHHHHcccCEEcccccccccEEEECccccccccccEEEEEcccccccccccccHHHHHHcccccccccccEEEEEEEccccccccHHccccEEEEEEEEEECccccccccccccccccc
*********************NHLRFTFLSIQSEAHAVLAGYSALLAVEAEQTELLNRACFGRHIVTAEKDKQWYQLGMEEGFYLCHSLKCLKIVGEDNSTKNDDELWQYMKAKKETFPLLYKAYSHLRKKNWVVRSGSQYGVDFVAYRHHPSLVHSEYAVLVLAEGEDGENGRLRVWSDIHCTVRLCGGVAKTLLILTINKNGQGTATPSCLEQYAVEERTISRWS****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPRWKGRASEAKSSGRSHVQNHLRFTFLSIQSEAHAVLAGYSALLAVEAEQTELLNRACFGRHIVTAEKDKQWYQLGMEEGFYLCHSLKCLKIVGEDNSTKNDDELWQYMKAKKETFPLLYKAYSHLRKKNWVVRSGSQYGVDFVAYRHHPSLVHSEYAVLVLAEGEDGENGRLRVWSDIHCTVRLCGGVAKTLLILTINKNGQGTATPSCLEQYAVEERTISRWSPEQCREDPATVANGIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA-splicing endonuclease subunit Sen2-2 Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. Probably carries the active site for 5'-splice site cleavage.probableQ9LSS3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.27.-Endoribonucleases producing other than 5'-phosphomonoesters.probable
3.1.27.9tRNA-intron endonuclease.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZYZ, chain B
Confidence level:very confident
Coverage over the Query: 35-203
View the alignment between query and template
View the model in PyMOL