Citrus Sinensis ID: 043882

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450------

MVAPEPETLSQGEVESALRADQHQKTLTLLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLTSIWNAEENQAINSSTQDSNINANNVINNAMSNNHTVQHLPVNETTAATTAHGSIVKQPSLSRQASLTLPAPLCRKTVEEVWSEIHRGKQGGHQQNSSNNNNNVRNPEAASRQPTFGEMTLEDFLIKAGVVREQNTTPVAQPPPQQQFGIYQTNNNPVMSPNFGTGHVLGLTGVSNGASNNGSVPVPAPAYQQMPPARGVVGSDQSSAYMGPTNEKGSGGYSATQQPPQPPPSPPPLAVCYGGRVGTGGGYASGGQPVAAMSPVSSEAVGTDQQVDGSASHQFGMDHMGGIRKKRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEMERKKKQQYFEELKMKPYTKAQKAKEKLRIMRRNLSCPL

ccccccccccccccccHHHHHcccccccccccccccccccHHHHHHHHHccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccc

*******************************RQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLTSIWNAEENQA*************************************************************LCRKTVEEVW*************************************TLEDFLIKAGVV******************IY***********FGTGHVLGLT******************************************************************VCYGGRVGT************************************************************************************ELEA*LNQLKE**AH***************************************RN*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVAPEPETLSQGEVESALRADQHQKTLTLLGRQSSIYSLTLDEFQHTLCESGKNFGSMNMDEFLTSIWNAEENQAINSSTQDSNINANNVINNAMSNNHTVQHLPVNETTAATTAHGSIVKQPSLSRQASLTLPAPLCRKTVEEVWSEIHRGKQGGHQQNSSNNNNNVRNPEAASRQPTFGEMTLEDFLIKAGVVREQNTTPVAQPPPQQQFGIYQTNNNPVMSPNFGTGHVLGLTGVSNGASNNGSVPVPAPAYQQMPPARGVVGSDQSSAYMGPTNEKGSGGYSATQQPPQPPPSPPPLAVCYGGRVGTGGGYASGGQPVAAMSPVSSEAVGTDQQVDGSASHQFGMDHMGGIRKKRIIDGPVEKVVERRQRRMIKNRESAARSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQYFEELKMKPYTKAQKAKEKLRIMRRNLSCPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein ABSCISIC ACID-INSENSITIVE 5	Participates in ABA-regulated gene expression during seed development and subsequent vegetative stage by acting as the major mediator of ABA repression of growth. Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 and Em6 genes promoters. Can also trans-activate its own promoter, suggesting that it is autoregulated. Plays a role in sugar-mediated senescence.	probable	Q9SJN0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WT7, chain A
Confidence level:confident
Coverage over the Query: 370-424
View the alignment between query and template
View the model in PyMOL

Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 238-250
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 416-450
View the alignment between query and template
View the model in PyMOL