Citrus Sinensis ID: 043891

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200

ALNTSAVTASLDNPASQLKNETSRPSRVIYFRIDVALRILLFVFSFVAILLIVTSKQTNLFPVPGTTFSVKIPAKFTYFPAFIYLFVALLVACLYSFITALTSLSTIRKLASRKRLLLLIAFLDTLMLGVVASAIGAALAVAYIGLKGNSHAGWNKQANAGYDKFIKHTATAIALSIFAVTDLVTLTMHSTYSLYKGVHN

ccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccCEEEEEEEECccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc

**************************RVIYFRIDVALRILLFVFSFVAILLIVTSKQTNLFPVPGTTFSVKIPAKFTYFPAFIYLFVALLVACLYSFITALTSLSTIRKLASRKRLLLLIAFLDTLMLGVVASAIGAALAVAYIGLKGNSHAGWNKQANAGYDKFIKHTATAIALSIFAVTDLVTLTMHSTYSLYKG***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
CASP-like protein POPTRDRAFT_820933		probable	B9HMP5
CASP-like protein 7		probable	C6SVQ5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted