Citrus Sinensis ID: 043909


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
RHTPYQSKRYVRSASHLNSQISEKNKRKGKMGLQEEFEEYAEKAKTLPESTTNENKLILYGLYKQATVGPVNTS
cccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccc
************************************FEEYAEKAKTLPESTTNENKLILYGLYKQATV******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RHTPYQSKRYVRSASHLNSQISEKNKRKGKMGLQEEFEEYAEKAKTLPESTTNENKLILYGLYKQATVGPVNTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-CoA-binding domain-containing protein 6 Binds medium- and long-chain acyl-CoA esters with very high affinity. May function as an intracellular carrier of acyl-CoA esters. Confers resistance to cold and freezing. Interacts with phosphatidylcholine and derivatives, but not phosphatidic acid and lysophosphatidylcholine. May be involved in phospholipid metabolism.probableP57752
Acyl-CoA-binding protein Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.probableO04066

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CQU, chain A
Confidence level:very confident
Coverage over the Query: 32-74
View the alignment between query and template
View the model in PyMOL