Citrus Sinensis ID: 043927

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11

MSFAAAAVPLNHASGGPPTGGSNDALYRELWHACAGPLATLPCEGQRVYYFPQGHMEQLEASMHQELEQQMPSFNLPSKILCKVVNVQRRAEPETDEVYAQITLLPEPD

cccccccccccccccccccccccccccHHHHHHHccccccccccccEEEECccccHHHHHHHHHHHHHcccccccccccEEEEEEEEEEEcccccccEEEEEEEEEccc

************************ALYRELWHACAGPLATLPCEGQRVYYFPQGHMEQLEASMHQELEQQMPSFNLPSKILCKVVNVQRRAEPETDEVYAQITLLPE**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSFAAAAVPLNHASGGPPTGGSNDALYRELWHACAGPLATLPCEGQRVYYFPQGHMEQLEASMHQELEQQMPSFNLPSKILCKVVNVQRRAEPETDEVYAQITLLPEPD

Annotation	Function Description	Confidence Level	Reference Protein
Auxin response factor 1	Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Seems to act as transcriptional repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Acts as repressor of IAA2, IAA3 and IAA7.	probable	Q8L7G0
Auxin response factor 9	Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	probable	Q0JCZ4

No EC number assigned to the protein, probably not an enzyme!

No confident structure templates for the query are predicted