Citrus Sinensis ID: 043968


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MTSPSNSAIFYSILFFLPIVLFLFRRQFSRKLNLPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALLAG
ccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHccEEEEEcccccEEEEccHHHHHHHHHHcccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEcccEcHHHHccccHHHHHHHHHHcccEEEEEEccccEEEEccHHHHHHHHHHcccHHccccccccc
mtspsnsaiFYSILFFLPIVLFLFRRQFsrklnlppgptpwpfignlnligplphvsihslsqkygplmhlkfglspvvvgsSAEVAELLLKTHdisfasrpallag
MTSPSNSAIFYSILFFLPIVLFLFRRQFSRKLNLPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKthdisfasrpallag
MTSPSNSAIFYSilfflpivlflfRRQFSRKLNLPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALLAG
*******AIFYSILFFLPIVLFLFRRQFSRKLNLPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISF*********
***PSNSAIFYSILFFLPIVLFL***************TPWPFIGNLNLIGPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALL**
MTSPSNSAIFYSILFFLPIVLFLFRRQFSRKLNLPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALLAG
**SPSNSAIFYSILFFLPIVLFLFRRQFSRKLNLPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFAS*******
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooo
ooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSPSNSAIFYSILFFLPIVLFLFRRQFSRKLNLPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALLAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query107 2.2.26 [Sep-21-2011]
Q9SD85 513 Flavonoid 3'-monooxygenas yes no 0.887 0.185 0.463 8e-19
C0SJS4 476 Psoralen synthase (Fragme N/A no 0.869 0.195 0.494 1e-18
C0SJS3 478 Angelicin synthase (Fragm N/A no 0.859 0.192 0.483 3e-18
Q6QNI4 494 Psoralen synthase OS=Ammi N/A no 0.785 0.170 0.528 4e-18
Q9LTM4 502 Cytochrome P450 71B19 OS= no no 0.925 0.197 0.465 7e-18
P58045 497 Cytochrome P450 71A14 OS= no no 0.766 0.164 0.512 1e-17
O65786 504 Cytochrome P450 71B4 OS=A no no 0.841 0.178 0.483 1e-17
Q9SAB6 497 Cytochrome P450 71A18 OS= no no 0.691 0.148 0.554 1e-17
C0SJS2 473 Psoralen synthase (Fragme N/A no 0.831 0.188 0.494 2e-17
Q9STL2 490 Cytochrome P450 71A21 OS= no no 0.869 0.189 0.5 2e-17
>sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 Back     alignment and function desciption
 Score = 92.4 bits (228), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 58/95 (61%)

Query: 8   AIFYSILFFLPIVLFLFRRQFSRKLNLPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYGP 67
            I  + + FL + +F  RR  S    LPPGP PWP IGNL  +G  PH ++ ++   YGP
Sbjct: 7   TILLATVLFLILRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRTLSAMVTTYGP 66

Query: 68  LMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRP 102
           ++HL+ G   VVV +S  VAE  LK HD +FASRP
Sbjct: 67  ILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRP 101




Catalyzes the 3'-hydroxylation of the flavonoid B-ring to the 3',4'-hydroxylated state. Convert naringenin to eriodictyol and dihydrokaempferol to dihydroquercetin.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 2EC: 1
>sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 Back     alignment and function description
>sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 Back     alignment and function description
>sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 Back     alignment and function description
>sp|P58045|C71AE_ARATH Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1 Back     alignment and function description
>sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 Back     alignment and function description
>sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 Back     alignment and function description
>sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 Back     alignment and function description
>sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
224119578 513 cytochrome P450 [Populus trichocarpa] gi 1.0 0.208 0.638 5e-31
225442104 511 PREDICTED: flavonoid 3'-monooxygenase-li 1.0 0.209 0.579 3e-27
297742991 477 unnamed protein product [Vitis vinifera] 1.0 0.224 0.579 3e-27
147826996 500 hypothetical protein VITISV_021888 [Viti 1.0 0.214 0.579 3e-27
125563880 518 hypothetical protein OsI_31533 [Oryza sa 0.869 0.179 0.635 9e-27
51091419 518 putative elicitor-inducible cytochrome P 0.869 0.179 0.635 1e-26
74273619 497 cytochrome P450 DDWF1 [Gossypium hirsutu 0.822 0.177 0.659 2e-26
354802082 516 CYP92A44-1 [Festuca rubra subsp. commuta 0.887 0.184 0.602 9e-26
125563879 514 hypothetical protein OsI_31532 [Oryza sa 0.897 0.186 0.59 9e-26
224147045 418 cytochrome P450 [Populus trichocarpa] gi 0.822 0.210 0.625 1e-25
>gi|224119578|ref|XP_002331195.1| cytochrome P450 [Populus trichocarpa] gi|222873316|gb|EEF10447.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/108 (63%), Positives = 79/108 (73%), Gaps = 1/108 (0%)

Query: 1   MTSPSNSAIFYSILFFLPIVLFLF-RRQFSRKLNLPPGPTPWPFIGNLNLIGPLPHVSIH 59
           M +P   AI Y+      +VL L  RR FSRKL LPPGP PWP IGN NLIGPLPH S+H
Sbjct: 1   MDNPPPPAITYTAAGLATVVLILLSRRLFSRKLKLPPGPKPWPIIGNFNLIGPLPHRSLH 60

Query: 60  SLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALLAG 107
            L++KYGP+M +KFG  PVVVGSSAEVAE +LKTHDIS A RP + AG
Sbjct: 61  ELAKKYGPIMQIKFGSIPVVVGSSAEVAEAILKTHDISLADRPKIAAG 108




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225442104|ref|XP_002273390.1| PREDICTED: flavonoid 3'-monooxygenase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742991|emb|CBI35858.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147826996|emb|CAN77776.1| hypothetical protein VITISV_021888 [Vitis vinifera] Back     alignment and taxonomy information
>gi|125563880|gb|EAZ09260.1| hypothetical protein OsI_31533 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|51091419|dbj|BAD36162.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica Group] gi|51535987|dbj|BAD38067.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|74273619|gb|ABA01477.1| cytochrome P450 DDWF1 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|354802082|gb|AER39771.1| CYP92A44-1 [Festuca rubra subsp. commutata] Back     alignment and taxonomy information
>gi|125563879|gb|EAZ09259.1| hypothetical protein OsI_31532 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|224147045|ref|XP_002336393.1| cytochrome P450 [Populus trichocarpa] gi|222834895|gb|EEE73344.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
UNIPROTKB|Q6QNI4 494 CYP71AJ1 "Psoralen synthase" [ 0.654 0.141 0.614 1.6e-17
TAIR|locus:2079316 500 CYP71B37 ""cytochrome P450, fa 0.738 0.158 0.566 7.6e-17
TAIR|locus:2093536 504 CYP71B4 ""cytochrome P450, fam 0.710 0.150 0.539 1.6e-16
TAIR|locus:2142878 513 TT7 "TRANSPARENT TESTA 7" [Ara 0.728 0.152 0.512 1.7e-16
TAIR|locus:2093516 502 CYP71B20 ""cytochrome P450, fa 0.700 0.149 0.546 3.4e-16
TAIR|locus:2093511 502 CYP71B19 ""cytochrome P450, fa 0.700 0.149 0.533 4.4e-16
TAIR|locus:2149383 497 CYP71A14 ""cytochrome P450, fa 0.738 0.158 0.531 7.1e-16
TAIR|locus:2093541 499 CYP71B21 ""cytochrome P450, fa 0.766 0.164 0.512 1.2e-15
TAIR|locus:2093521 500 CYP71B22 ""cytochrome P450, fa 0.710 0.152 0.552 1.5e-15
TAIR|locus:504955640 490 CYP71A22 ""cytochrome P450, fa 0.728 0.159 0.538 4e-15
UNIPROTKB|Q6QNI4 CYP71AJ1 "Psoralen synthase" [Ammi majus (taxid:48026)] Back     alignment and assigned GO terms
 Score = 221 (82.9 bits), Expect = 1.6e-17, P = 1.6e-17
 Identities = 43/70 (61%), Positives = 50/70 (71%)

Query:    33 NLPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLK 92
             NLPP P  +P IGNL+ IGP P  S+  L+QKYGPLM LKFG  PV+V SSA+ A   LK
Sbjct:    36 NLPPSPPQYPIIGNLHQIGPDPQASLRDLAQKYGPLMFLKFGTVPVLVVSSADAAREALK 95

Query:    93 THDISFASRP 102
             THD+ FA RP
Sbjct:    96 THDLVFADRP 105




GO:0002238 "response to molecule of fungal origin" evidence=IDA
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IDA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
TAIR|locus:2079316 CYP71B37 ""cytochrome P450, family 71, subfamily B, polypeptide 37"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093536 CYP71B4 ""cytochrome P450, family 71, subfamily B, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142878 TT7 "TRANSPARENT TESTA 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093516 CYP71B20 ""cytochrome P450, family 71, subfamily B, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093511 CYP71B19 ""cytochrome P450, family 71, subfamily B, polypeptide 19"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149383 CYP71A14 ""cytochrome P450, family 71, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093541 CYP71B21 ""cytochrome P450, family 71, subfamily B, polypeptide 21"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093521 CYP71B22 ""cytochrome P450, family 71, subfamily B, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955640 CYP71A22 ""cytochrome P450, family 71, subfamily A, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 8e-30
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 6e-23
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 1e-20
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 4e-20
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 1e-16
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-15
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 7e-14
pfam00067 461 pfam00067, p450, Cytochrome P450 1e-12
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 1e-08
PLN02196 463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 7e-07
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 1e-06
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 4e-05
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 2e-04
PLN02500 490 PLN02500, PLN02500, cytochrome P450 90B1 7e-04
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 0.001
PLN02987 472 PLN02987, PLN02987, Cytochrome P450, family 90, su 0.003
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
 Score =  110 bits (277), Expect = 8e-30
 Identities = 41/96 (42%), Positives = 59/96 (61%), Gaps = 2/96 (2%)

Query: 9   IFYSILFFLPIVLFLFRRQFSRKLN--LPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYG 66
           +  ++   + +   L RR  S K    LPPGP  WP +GNL  +GP PH ++ +L++ YG
Sbjct: 8   LLGTVAVSVLVWCLLLRRGGSGKHKRPLPPGPRGWPVLGNLPQLGPKPHHTMAALAKTYG 67

Query: 67  PLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRP 102
           PL  L+FG   VVV +SA VA   L+THD +F++RP
Sbjct: 68  PLFRLRFGFVDVVVAASASVAAQFLRTHDANFSNRP 103


Length = 517

>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.79
PLN02687 517 flavonoid 3'-monooxygenase 99.67
PLN03234 499 cytochrome P450 83B1; Provisional 99.63
PLN02183 516 ferulate 5-hydroxylase 99.63
PLN03112 514 cytochrome P450 family protein; Provisional 99.62
PLN02971 543 tryptophan N-hydroxylase 99.62
PTZ00404 482 cytochrome P450; Provisional 99.59
PLN00168 519 Cytochrome P450; Provisional 99.58
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.57
PLN02966 502 cytochrome P450 83A1 99.53
PLN02394 503 trans-cinnamate 4-monooxygenase 99.53
PLN02500 490 cytochrome P450 90B1 99.49
PLN02196 463 abscisic acid 8'-hydroxylase 99.47
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.46
PLN02655 466 ent-kaurene oxidase 99.46
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.45
PLN02774 463 brassinosteroid-6-oxidase 99.44
PLN02290 516 cytokinin trans-hydroxylase 99.39
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.36
PLN03018 534 homomethionine N-hydroxylase 99.34
PLN02302 490 ent-kaurenoic acid oxidase 99.31
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.28
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.17
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.09
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.06
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.02
PLN02936 489 epsilon-ring hydroxylase 98.79
PLN02648 480 allene oxide synthase 98.73
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 98.58
PLN02738 633 carotene beta-ring hydroxylase 98.52
PLN02426 502 cytochrome P450, family 94, subfamily C protein 97.36
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=99.79  E-value=1.8e-18  Score=117.80  Aligned_cols=72  Identities=54%  Similarity=0.930  Sum_probs=69.3

Q ss_pred             CCCCCCCCCCceeeeccccCCC-hHHHHHHHHHHcCCeeEEEcCCcCEEEecCHHHHHHHHhhccccccCCCC
Q 043968           32 LNLPPGPTPWPFIGNLNLIGPL-PHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPA  103 (107)
Q Consensus        32 ~~~~p~~~~~p~~g~~~~~~~~-~~~~~~~~~~~~g~~~~~~~~~~~~v~~~~p~~~~~vl~~~~~~~~~r~~  103 (107)
                      .+.||||+++|++||++++... .+..+.++.++||+++.+|+|..|.++++|+|.++++|.+++..|++||.
T Consensus        25 ~~lPPGP~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~   97 (489)
T KOG0156|consen   25 RNLPPGPPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPD   97 (489)
T ss_pred             CCCCcCCCCCCccccHHHcCCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCC
Confidence            7789999999999999999765 99999999999999999999999999999999999999999999999997



>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 6e-10
3pm0_A 507 Structural Characterization Of The Complex Between 9e-09
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 8e-08
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 5e-07
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-06
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 4e-06
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 4e-06
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 8e-06
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 8e-06
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 1e-05
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-05
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 1e-05
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-05
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 1e-05
3qz1_A 496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 4e-04
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure

Iteration: 1

Score = 58.9 bits (141), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 28/80 (35%), Positives = 45/80 (56%) Query: 25 RRQFSRKLNLPPGPTPWPFIGNLNLIGPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSA 84 ++ S+ L PPGP WP IG++ +G PH+++ +SQ+YG ++ ++ G +PVVV S Sbjct: 3 KKTSSKGLKNPPGPWGWPLIGHMLTLGKNPHLALSRMSQQYGDVLQIRIGSTPVVVLSGL 62 Query: 85 EVAELLLKTHDISFASRPAL 104 + L F RP L Sbjct: 63 DTIRQALVRQGDDFKGRPDL 82
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 8e-28
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-24
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-21
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-21
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-20
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 5e-20
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-19
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-19
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 7e-19
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-18
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-18
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 3e-18
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 3e-18
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 6e-18
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-17
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 7e-14
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 5e-12
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 1e-10
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-09
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-08
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 7e-08
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 5e-07
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 7e-07
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-06
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-04
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  103 bits (260), Expect = 8e-28
 Identities = 12/86 (13%), Positives = 31/86 (36%), Gaps = 1/86 (1%)

Query: 19  IVLFLFRRQFSRKLNLPPGPTPW-PFIGNLNLIGPLPHVSIHSLSQKYGPLMHLKFGLSP 77
               +   + +R+ N PP      P++G+    G      +  + +K+G +  ++     
Sbjct: 4   KTSSVLYGRRTRRRNEPPLDKGMIPWLGHALEFGKDAAKFLTRMKEKHGDIFTVRAAGLY 63

Query: 78  VVVGSSAEVAELLLKTHDISFASRPA 103
           + V   +   + +L        +  A
Sbjct: 64  ITVLLDSNCYDAVLSDVASLDQTSYA 89


>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.69
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.57
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.55
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.55
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.54
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.51
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.48
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.42
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.42
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.42
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.4
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.39
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.37
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.33
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.33
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.32
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.31
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.29
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.25
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.22
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.2
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.19
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.12
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.09
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.08
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.05
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 98.8
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 98.65
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 98.54
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 98.53
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 98.47
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 98.45
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 98.38
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 98.33
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 98.22
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 98.22
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 98.21
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 98.2
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 98.18
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 98.18
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 98.15
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 98.14
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 98.11
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 98.07
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 98.06
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 98.05
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 98.05
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 97.94
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 97.93
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 97.88
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 97.87
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 97.86
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 97.84
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 97.82
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 97.81
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 97.74
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 97.7
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 97.66
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 97.65
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 97.55
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 97.54
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 97.5
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 97.35
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 97.32
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 97.24
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 97.13
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 97.01
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 96.95
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 96.9
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 96.8
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 96.8
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 96.16
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 94.94
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 94.74
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 93.44
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 90.64
2krb_A81 Eukaryotic translation initiation factor 3 subunit 89.37
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 88.45
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 88.21
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 87.5
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 85.32
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 80.26
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.69  E-value=5.2e-17  Score=108.62  Aligned_cols=78  Identities=32%  Similarity=0.471  Sum_probs=68.3

Q ss_pred             ccCCCCCCCCCCCCceeeecccc-CCChHHHHHHHHHHcCCeeEEEcCCcCEEEecCHHHHHHHHhhccccccCCCCcc
Q 043968           28 FSRKLNLPPGPTPWPFIGNLNLI-GPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALL  105 (107)
Q Consensus        28 ~~~~~~~~p~~~~~p~~g~~~~~-~~~~~~~~~~~~~~~g~~~~~~~~~~~~v~~~~p~~~~~vl~~~~~~~~~r~~~~  105 (107)
                      .+++.+.||||+++|++||++++ ..+.+..+.+++++||+++++++|+.+.++++||+.+++||.++...|++||...
T Consensus         5 ~ss~~kLPPGP~~lP~iGn~~~~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~i~~vl~~~~~~f~~r~~~~   83 (479)
T 3tbg_A            5 TSSKGKLPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVP   83 (479)
T ss_dssp             ----CCCCCCSCCBTTTBTGGGCCTTSHHHHHHHHHHHHCSEEEEEETTEEEEEEEHHHHHHHHHTTTGGGSCBCCCCG
T ss_pred             CCCCCCCCCCCCCcCcccchHhhcCCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCChhhcCCCchH
Confidence            33444678999999999999998 5788889999999999999999999999999999999999999999999998654



>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 107
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-21
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 3e-21
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 4e-20
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-19
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 6e-19
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-17
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 6e-11
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 3e-06
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 85.6 bits (210), Expect = 1e-21
 Identities = 30/70 (42%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 34  LPPGPTPWPFIGNLNLIG-PLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLK 92
           LPPGPTP P IGN+  IG      S+ +LS+ YGP+  L FGL P+VV    E  +  L 
Sbjct: 4   LPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALI 63

Query: 93  THDISFASRP 102
                F+ R 
Sbjct: 64  DLGEEFSGRG 73


>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.63
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.59
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.58
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.54
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.47
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.43
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 98.61
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 98.22
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 98.19
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 97.86
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 97.31
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 97.13
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 96.74
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 96.36
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 95.34
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 95.01
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 93.29
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 90.3
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 90.21
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 88.71
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 87.72
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 87.54
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 87.23
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 86.12
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 85.9
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 85.57
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 84.56
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 83.7
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 83.34
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 81.84
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 81.42
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 81.33
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 81.02
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 80.9
d2cpja186 Non-POU domain-containing octamer-binding protein, 80.61
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.63  E-value=2e-16  Score=103.38  Aligned_cols=74  Identities=39%  Similarity=0.570  Sum_probs=61.9

Q ss_pred             CCCCCCCCCCceeeecccc-CCChHHHHHHHHHHcCCeeEEEcCCcCEEEecCHHHHHHHHhhccccccCCCCcc
Q 043968           32 LNLPPGPTPWPFIGNLNLI-GPLPHVSIHSLSQKYGPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALL  105 (107)
Q Consensus        32 ~~~~p~~~~~p~~g~~~~~-~~~~~~~~~~~~~~~g~~~~~~~~~~~~v~~~~p~~~~~vl~~~~~~~~~r~~~~  105 (107)
                      .+.||||+++|++|+++++ ..+++..+.+++++||+++++|+|+.+.++++|||.+++|+.++...|++|+...
T Consensus         2 ~~lPPGP~~~P~lG~~~~l~~~~~~~~~~~~~~kyG~i~~~~~g~~~~vvv~dpe~i~~il~~~~~~f~~r~~~~   76 (467)
T d1r9oa_           2 GKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFP   76 (467)
T ss_dssp             CBCCCCSSSCC-----CCBCHHHHHHHHHHHHHHHCSEEEEESSSCEEEEECSHHHHHHHHTTTTTTTCEECCCS
T ss_pred             CCCCcCCCCCCccccHHHhCCcCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCCcccCCCCcch
Confidence            4678999999999999988 3668889999999999999999999999999999999999999988998887654



>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure