Citrus Sinensis ID: 043977

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-----

MLESTNADSKSWKVLIMDKVTVKVMSHSCKMADITDRGVSLVEDLFRRRQPLPSMDAVYFIQPSKENVVMFLSDMSGREPLYKKAYVFFSTPIPKELVNHIKSDTSVLPRIGALREMNLEYFPIDRQAFITDHERALEELFGDNVQNTRQFDTCLNTMAKRIATVFASMKEFPMVRYRAPKASDASTTTFRDLIPSKLATAVWNCIEKYKSIPNFPQTETCELLILDRSVDQIAPVIHEWTYDAMCHDLLDMDGNKYVLEVPSKTGGQPEKKEVLLEDHDPVWLELRHAHIADASERLHDKMTNFVSKNKAAQIQQSSRDGGELSTRDLQKIVQALPQYSEQVDKLSLHVEIAGKINHIIREIGLRDLGQLEQDLVFGDAGAKDVINFLRMKQDVTPENKLRLLMIYASVYPEKFEGDKASKLMQLARLSSEDMKIVNNMRLLAGSLNSKKSSTDFSLKFDGQKTKQAARKERPGEEETWALFKFYPIIEELIENLCKGELPKSDYPCMNHPSSAEQESTSRFSVRKKAAPATTAPSEKKTGHSVRSRRTPSWAKPQNSDDGYSSDSILNHAVADLRKMGQRIFVFMIGGATRSELRACYKLTTKLRREVVLGSTSFNDPPEYIS

ccccccccccccEEEEEccccccHHHccccHHHHHHccccEEEEccccccccccccEEEEEcccHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHccccccccccEEEcccccccccccEEEEccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHcHHHHHHHHHHHHHHcccccccccccccEEEEEcccccccccccHHHHHHHHHHHHccccccEEEEEEccccccccccEEEEcccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHcccccccccccHHHccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHcccEEEEccccccccccccc

********SKSWKVLIMDKVTVKVMSHSCKMADITDRGVSLVEDLFRRRQPLPSMDAVYFIQPSKENVVMFLSDMSGREPLYKKAYVFFSTPIPKELVNHIKSDTSVLPRIGALREMNLEYFPIDRQAFITDHERALEELFGDNVQNTRQFDTCLNTMAKRIATVFASMKEFPMVRYRAPKASDASTTTFRDLIPSKLATAVWNCIEKYKSIPNFPQTETCELLILDRSVDQIAPVIHEWTYDAMCHDLLDMDGNKYVLEV************VLLEDHDPVWLELRHAHIADASERLHDKMT************************DLQKIVQALPQYSEQVDKLSLHVEIAGKINHIIREIGLRDLGQLEQDLVFGDAGAKDVINFLRMKQDVTPENKLRLLMIYASVYPEKFEGDKASKLMQLARLSSEDMKIVNNMRL************************************TWALFKFYPIIEELIENLCKGELPKSDYPCMNHP************************************************************V****KMGQRIFVFMIGGATRSELRACYKLTTKLRREVVLGSTSFNDPPEYIS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein transport Sec1a	Involved in the vesicle trafficking. Binds syntaxins.	confident	Q9C5P7
Probable protein transport Sec1b	Involved in the vesicle trafficking. Binds syntaxins.	probable	Q5VNU3
Probable protein transport Sec1a	Involved in the vesicle trafficking. Binds syntaxins.	probable	Q7XWP3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XHE, chain A
Confidence level:very confident
Coverage over the Query: 10-182,193-523,581-625
View the alignment between query and template
View the model in PyMOL

Template: 1FVF, chain A
Confidence level:confident
Coverage over the Query: 12-258,270-310,329-513,580-620
View the alignment between query and template
View the model in PyMOL