Citrus Sinensis ID: 043978


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680---
ICDNVTGNVIGLDLHGSCSWLRGTIDDNSTLFRLSHLQSLNLAFNNFLGSRISPEFGRLKELTYLNPSFSNFGGLVPSEISHLSKLTHLGLSCRVLTIEQRTFDLLASNLTKLSLLHLGSTNLSLIKPFSLLNLSSTMTDLDLSGTRIQGNFPDQIFLLPNLRVLYLCGNIHLTGYLPKCNWSSPLRELDLSLSDFSGEIPYSIGNLLFLETVDITYCNFMGSIPTSTGNLSKATEILFASNHLTGQLPHHVSGLLYLTNLDLFGNSLQGKVPSWLFTLPSLVSVNLAWNKLTGPIDGFQSPNSLEEVHLEKNQIHGTIPSSLFQLCGTIRFDQFSKLKNLQFLDLSNNNLLSFTSSGNIDIKYSLPSLLKLSFSNCNVSEFPSFLRNSEKIHGRISKHDSKGWKSLIDLDLSNNFLTHIALHPWKNIRTLDLRNNKIQGSILVPPPSTEVFLVSNNKLSGQIPPYICSLSSLKYLSLSHNNLSGTIPPCLGNFTTQLITLHLKNNSLEGHIHDTFENASNIQSFDLNCNKFEGSLPRSLAKCVKLEVVNVGNNMINDTFPCWLGSLPLLKILILRSNRFYGPLCKSITTFSFQALRIIDLSRNEFKDFLPRRNFTSMEAMKNVDEQATRLQYMGHAYYDESVTVAMKGHDFQLYMLNLDQIYIPNQESPGLAELSNQELRMV
ccccccccEEEEEccccccccCEECcccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccccccccHHHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccCECccccccccccccEEEcccccccccccHHHccccccccccccccCEECcccccccccccccEEEccccccCCcccHHHcccccccEEEccccccCECcccccccccccEEEccccccCCcccccccccccccccccccccccccEEEcccccccccccccccccccccccccCECcccccccccccccccccccCECccHHHHHccccccEEEccccccccccccccccccEEEccccccCCccccccccccEEEccccEEECcccHHccccccccEEEcccccccccccHHHHcccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccCECccccccccccccccEEEcccccccccccHHHHHHHHccccccccccEEEEcccccEEEEEEEEEccCEEEEEEEccccCEECcccccccccccccccccc
ICDNVTGNVIGLDLHGSCSWLRGTIDDNSTLFRLSHLQSLNLAFNNFLGSRISPEFGRLKELTYLNPSFSNFGGLVPSEISHLSKLTHLGLSCRVLTIEQRTFDLLASNLTKLSLLHLGSTNLSLIKPFSLLNLSSTMTDLDLSGTRIQGNFPDQIFLLPNLRVLYLCGNIHLTGYLPKCNWSSPLRELDLSLSDFSGEIPYSIGNLLFLETVDITYCNFMGSIPTSTGNLSKATEILFASNHLTGQLPHHVSGLLYLTNLDLFGNSLQGKVPSWLFTLPSLVSVNLAWNKLTGPIDGFQSPNSLEEVHLEKNQIHGTIPSSLFQLCGTIRFDQFSKLKNLQFLDLSNNNLLSFTSSGNIDIKYSLPSLLKLSFSNCNVSEFPSFLRNSEKIHGRISKHDSKGWKSLIDLDLSNNFLTHIALHPWKNIRTLDLRNNKIQGSILVPPPSTEVFLVSNNKLSGQIPPYICSLSSLKYLSLSHNNLSGTIPPCLGNFTTQLITLHLKNNSLEGHIHDTFENASNIQSFDLNCNKFEGSLPRSLAKCVKLEVVNVGNNMINDTFPCWLGSLPLLKILILRSNRFYGPLCKSITTFSFQALRIIDLSRNEFKDFLPRRNFTSMEAMKNVDEQATRLQYMGHAYYDESVTVAMKGHDFQLYMLNLDQIYIPNQESPGLAELSNQELRMV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ICDNVTGNVIGLDLHGSCSWLRGTIDDNSTLFRLSHLQSLNLAFNNFLGSRISPEFGRLKELTYLNPSFSNFGGLVPSEISHLSKLTHLGLSCRVLTIEQRTFDLLASNLTKLSLLHLGSTNLSLIKPFSLLNLSSTMTDLDLSGTRIQGNFPDQIFLLPNLRVLYLCGNIHLTGYLPKCNWSSPLRELDLSLSDFSGEIPYSIGNLLFLETVDITYCNFMGSIPTSTGNLSKATEILFASNHLTGQLPHHVSGLLYLTNLDLFGNSLQGKVPSWLFTLPSLVSVNLAWNKLTGPIDGFQSPNSLEEVHLEKNQIHGTIPSSLFQLCGTIRFDQFSKLKNLQFLDLSNNNLLSFTSSGNIDIKYSLPSLLKLSFSNCNVSEFPSFLRNSEKIHGRISKHDSKGWKSLIDLDLSNNFLTHIALHPWKNIRTLDLRNNKIQGSILVPPPSTEVFLVSNNKLSGQIPPYICSLSSLKYLSLSHNNLSGTIPPCLGNFTTQLITLHLKNNSLEGHIHDTFENASNIQSFDLNCNKFEGSLPRSLAKCVKLEVVNVGNNMINDTFPCWLGSLPLLKILILRSNRFYGPLCKSITTFSFQALRIIDLSRNEFKDFLPRRNFTSMEAMKNVDEQATRLQYMGHAYYDESVTVAMKGHDFQLYMLNLDQIYIPNQESPGLAELSNQELRMV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 60-95,110-304,341-385,404-531
View the alignment between query and template
View the model in PyMOL
Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 136-172,183-320,334-385,402-579
View the alignment between query and template
View the model in PyMOL
Template: 3V47, chain A
Confidence level:very confident
Coverage over the Query: 63-158,183-278,294-355,374-385,400-404,424,446-585
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 10-385,400-635
View the alignment between query and template
View the model in PyMOL
Template: 3BZ5, chain A
Confidence level:very confident
Coverage over the Query: 129-318,334-337,366-385,402-438,450-506,520-661
View the alignment between query and template
View the model in PyMOL
Template: 3FXI, chain A
Confidence level:confident
Coverage over the Query: 97-606
View the alignment between query and template
View the model in PyMOL