Citrus Sinensis ID: 044004

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
SASSANSTVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMKENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNIFVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICRFVSHLLP
cccEEEEEEccccccccccHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccEEccccccHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHccccccccccccccccc
cccEEEEEEEcccHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccEEccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHHccHHHHHHHHHHccc
sassanstvgalgdlakkkiFPALFVLYYedclpedftvfgyartkltdedmRNVISKTLTCRIDMKENCEDKMDQFLKRCfyhsglynseeHFAELDSKLKEKECKKMVFWARKLSNrlfylsippniFVEVAKCaslrapsttgwtrvivekpfgrdsvssgeLTRSLKQYLRENQICRFVSHLLP
sassanstvgalgdlakkkIFPALFVLYYEDCLPEDFTVFGYArtkltdedmrnvISKTLTCRIDMKENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNIFVEVAKCASLrapsttgwtrvivekpfgrdsvssgeLTRSLKQYLRENQICRFVSHLLP
SASSANSTVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMKENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNIFVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICRFVSHLLP
**********ALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMKENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNIFVEVAKCASLRAPSTTGWTRVIVEKPFGR********TRSLKQYLRENQICRFVSH***
*ASSANSTVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLT*********EDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNIFVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICRFVSHLLP
*********GALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMKENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNIFVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICRFVSHLLP
*ASSANSTVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMKENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNIFVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICRFVSHLLP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SASSANSTVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMKENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNIFVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICRFVSHLLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query188 2.2.26 [Sep-21-2011]
Q43727 576 Glucose-6-phosphate 1-deh yes no 0.920 0.300 0.734 3e-72
Q43839 577 Glucose-6-phosphate 1-deh N/A no 0.920 0.299 0.701 3e-69
Q43793 593 Glucose-6-phosphate 1-deh N/A no 0.920 0.291 0.696 3e-69
Q9FY99 596 Glucose-6-phosphate 1-deh no no 0.920 0.290 0.679 4e-69
O24357 574 Glucose-6-phosphate 1-deh N/A no 0.914 0.299 0.692 3e-68
Q8L743 599 Glucose-6-phosphate 1-deh no no 0.920 0.288 0.672 1e-67
Q93ZW0 625 Glucose-6-phosphate 1-deh no no 0.946 0.284 0.473 1e-42
Q557D2 497 Glucose-6-phosphate 1-deh yes no 0.893 0.338 0.418 3e-30
Q9LK23 516 Glucose-6-phosphate 1-deh no no 0.936 0.341 0.413 4e-30
Q42919 515 Glucose-6-phosphate 1-deh N/A no 0.941 0.343 0.409 7e-30
>sp|Q43727|G6PD1_ARATH Glucose-6-phosphate 1-dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=APG1 PE=2 SV=2 Back     alignment and function desciption
 Score =  270 bits (691), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 149/181 (82%), Gaps = 8/181 (4%)

Query: 7   STVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDM 66
           + VGA GDLAKKKIFPALF L+YE CLP+DF+VFGYARTKLT E++R++IS TLTCRID 
Sbjct: 94  TVVGASGDLAKKKIFPALFALFYEGCLPQDFSVFGYARTKLTHEELRDMISSTLTCRIDQ 153

Query: 67  KENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIP 126
           +E C DKM+QFLKRCFYHSG YNSEE FAEL+ KLKEKE       A K+SNRL+YLSIP
Sbjct: 154 REKCGDKMEQFLKRCFYHSGQYNSEEDFAELNKKLKEKE-------AGKISNRLYYLSIP 206

Query: 127 PNIFVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICRFVSHL 186
           PNIFV+V +CASLRA S  GWTRVIVEKPFGRDS SSGELTR LKQYL E QI R + H 
Sbjct: 207 PNIFVDVVRCASLRASSENGWTRVIVEKPFGRDSESSGELTRCLKQYLTEEQIFR-IDHY 265

Query: 187 L 187
           L
Sbjct: 266 L 266
Catalyzes the rate-limiting step of the oxidative pentose-phosphate pathway, which represents a route for the dissimilation of carbohydrates besides glycolysis. The main function of this enzyme is to provide reducing power (NADPH) and pentose phosphates for fatty acid and nucleic acid synthesis which are involved in membrane synthesis and cell division.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 9
>sp|Q43839|G6PDC_SOLTU Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Solanum tuberosum PE=1 SV=1 Back     alignment and function description
>sp|Q43793|G6PDC_TOBAC Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q9FY99|G6PD2_ARATH Glucose-6-phosphate 1-dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=At5g13110 PE=2 SV=2 Back     alignment and function description
>sp|O24357|G6PDC_SPIOL Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Spinacia oleracea GN=G6PD PE=2 SV=1 Back     alignment and function description
>sp|Q8L743|G6PD3_ARATH Glucose-6-phosphate 1-dehydrogenase 3, chloroplastic OS=Arabidopsis thaliana GN=At1g24280 PE=2 SV=2 Back     alignment and function description
>sp|Q93ZW0|G6PD4_ARATH Glucose-6-phosphate 1-dehydrogenase 4, chloroplastic OS=Arabidopsis thaliana GN=At1g09420 PE=2 SV=1 Back     alignment and function description
>sp|Q557D2|G6PD_DICDI Glucose-6-phosphate 1-dehydrogenase OS=Dictyostelium discoideum GN=g6pd-1 PE=3 SV=1 Back     alignment and function description
>sp|Q9LK23|G6PD5_ARATH Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 1 OS=Arabidopsis thaliana GN=ACG9 PE=2 SV=1 Back     alignment and function description
>sp|Q42919|G6PD_MEDSA Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform OS=Medicago sativa PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
380863004229 glucose-6-phosphate dehydrogenase, parti 0.914 0.751 0.783 7e-75
449453209 594 PREDICTED: glucose-6-phosphate 1-dehydro 0.920 0.291 0.762 2e-73
356522804 588 PREDICTED: LOW QUALITY PROTEIN: glucose- 0.920 0.294 0.75 3e-73
255578725 593 glucose-6-phosphate 1-dehydrogenase, put 0.920 0.291 0.75 5e-72
224131858 571 predicted protein [Populus trichocarpa] 0.920 0.302 0.751 7e-72
297805130 578 glucose-6-phosphate dehydrogenase 1 [Ara 0.920 0.299 0.734 3e-71
356528894 588 PREDICTED: glucose-6-phosphate 1-dehydro 0.920 0.294 0.727 5e-71
15238612 576 glucose-6-phosphate dehydrogenase 1 [Ara 0.920 0.300 0.734 1e-70
1174336 514 glucose-6-phosphate 1-dehydrogenase [Ara 0.920 0.336 0.727 7e-70
125558036 589 hypothetical protein OsI_25709 [Oryza sa 0.925 0.295 0.685 5e-69
>gi|380863004|gb|AFF18795.1| glucose-6-phosphate dehydrogenase, partial [Dimocarpus longan] Back     alignment and taxonomy information
 Score =  285 bits (729), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 153/180 (85%), Gaps = 8/180 (4%)

Query: 8   TVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMK 67
            VGA GDLAKKKIFPALF L+YED LPEDF VFGYARTKLTDE++R++ISKTLTCRID +
Sbjct: 1   VVGASGDLAKKKIFPALFALFYEDFLPEDFNVFGYARTKLTDEELRDMISKTLTCRIDQR 60

Query: 68  ENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPP 127
           ENCEDKMDQFLKRCFYHSG YNSEEHFAELD KLKEKE       A + SNRLFYLSIPP
Sbjct: 61  ENCEDKMDQFLKRCFYHSGQYNSEEHFAELDIKLKEKE-------AGRKSNRLFYLSIPP 113

Query: 128 NIFVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICRFVSHLL 187
           NIFV+V KCA L+A S  GWTRVIVEKPFGRDS SSGELT+SLKQYLRE+QI R + H L
Sbjct: 114 NIFVDVVKCAILKASSANGWTRVIVEKPFGRDSESSGELTKSLKQYLREDQIFR-IDHYL 172

Source: Dimocarpus longan

Species: Dimocarpus longan

Genus: Dimocarpus

Family: Sapindaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449453209|ref|XP_004144351.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356522804|ref|XP_003530034.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-phosphate 1-dehydrogenase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255578725|ref|XP_002530221.1| glucose-6-phosphate 1-dehydrogenase, putative [Ricinus communis] gi|223530268|gb|EEF32168.1| glucose-6-phosphate 1-dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224131858|ref|XP_002321196.1| predicted protein [Populus trichocarpa] gi|222861969|gb|EEE99511.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297805130|ref|XP_002870449.1| glucose-6-phosphate dehydrogenase 1 [Arabidopsis lyrata subsp. lyrata] gi|297316285|gb|EFH46708.1| glucose-6-phosphate dehydrogenase 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356528894|ref|XP_003533032.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|15238612|ref|NP_198428.1| glucose-6-phosphate dehydrogenase 1 [Arabidopsis thaliana] gi|21903429|sp|Q43727.2|G6PD1_ARATH RecName: Full=Glucose-6-phosphate 1-dehydrogenase 1, chloroplastic; Short=G6PD1; Short=G6PDH1; Flags: Precursor gi|10176696|dbj|BAB09918.1| glucose-6-phosphate dehydrogenase [Arabidopsis thaliana] gi|20466191|gb|AAM20413.1| glucose-6-phosphate dehydrogenase [Arabidopsis thaliana] gi|21592340|gb|AAM64291.1| glucose-6-phosphate dehydrogenase [Arabidopsis thaliana] gi|25083966|gb|AAN72144.1| glucose-6-phosphate dehydrogenase [Arabidopsis thaliana] gi|332006635|gb|AED94018.1| glucose-6-phosphate dehydrogenase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|1174336|emb|CAA59012.1| glucose-6-phosphate 1-dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|125558036|gb|EAZ03572.1| hypothetical protein OsI_25709 [Oryza sativa Indica Group] gi|125599908|gb|EAZ39484.1| hypothetical protein OsJ_23916 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query188
TAIR|locus:2165154 576 G6PD1 "glucose-6-phosphate deh 0.920 0.300 0.734 1.7e-66
TAIR|locus:2179887 596 G6PD2 "glucose-6-phosphate deh 0.952 0.300 0.670 2e-63
TAIR|locus:2032412 599 G6PD3 "glucose-6-phosphate deh 0.920 0.288 0.674 1e-61
TAIR|locus:2086558 516 G6PD5 "glucose-6-phosphate deh 0.930 0.339 0.415 1.6e-29
TAIR|locus:2154805 515 G6PD6 "glucose-6-phosphate deh 0.914 0.333 0.416 7.7e-29
DICTYBASE|DDB_G0273639 497 g6pd-2 "glucose 6-phosphate-1- 0.893 0.338 0.424 2.9e-28
DICTYBASE|DDB_G0273131 497 g6pd-1 "glucose 6-phosphate-1- 0.893 0.338 0.424 2.9e-28
POMBASE|SPAC3A12.18 500 zwf1 "glucose-6-phosphate 1-de 0.898 0.338 0.402 3e-28
SGD|S000005185 505 ZWF1 "Glucose-6-phosphate dehy 0.925 0.344 0.412 2.6e-27
UNIPROTKB|G4MR82 507 MGG_09926 "Glucose-6-phosphate 0.893 0.331 0.405 2.1e-26
TAIR|locus:2165154 G6PD1 "glucose-6-phosphate dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 676 (243.0 bits), Expect = 1.7e-66, P = 1.7e-66
 Identities = 133/181 (73%), Positives = 149/181 (82%)

Query:     7 STVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDM 66
             + VGA GDLAKKKIFPALF L+YE CLP+DF+VFGYARTKLT E++R++IS TLTCRID 
Sbjct:    94 TVVGASGDLAKKKIFPALFALFYEGCLPQDFSVFGYARTKLTHEELRDMISSTLTCRIDQ 153

Query:    67 KENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIP 126
             +E C DKM+QFLKRCFYHSG YNSEE FAEL+ KLKEKE       A K+SNRL+YLSIP
Sbjct:   154 REKCGDKMEQFLKRCFYHSGQYNSEEDFAELNKKLKEKE-------AGKISNRLYYLSIP 206

Query:   127 PNIFVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICRFVSHL 186
             PNIFV+V +CASLRA S  GWTRVIVEKPFGRDS SSGELTR LKQYL E QI R + H 
Sbjct:   207 PNIFVDVVRCASLRASSENGWTRVIVEKPFGRDSESSGELTRCLKQYLTEEQIFR-IDHY 265

Query:   187 L 187
             L
Sbjct:   266 L 266
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004345 "glucose-6-phosphate dehydrogenase activity" evidence=IEA;ISS;IDA
GO:0006006 "glucose metabolic process" evidence=IEA;ISS;IDA
GO:0009507 "chloroplast" evidence=ISM;ISS;IDA
GO:0050661 "NADP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009051 "pentose-phosphate shunt, oxidative branch" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009637 "response to blue light" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0015979 "photosynthesis" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0046777 "protein autophosphorylation" evidence=RCA
TAIR|locus:2179887 G6PD2 "glucose-6-phosphate dehydrogenase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032412 G6PD3 "glucose-6-phosphate dehydrogenase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086558 G6PD5 "glucose-6-phosphate dehydrogenase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154805 G6PD6 "glucose-6-phosphate dehydrogenase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273639 g6pd-2 "glucose 6-phosphate-1-dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273131 g6pd-1 "glucose 6-phosphate-1-dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC3A12.18 zwf1 "glucose-6-phosphate 1-dehydrogenase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000005185 ZWF1 "Glucose-6-phosphate dehydrogenase (G6PD)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G4MR82 MGG_09926 "Glucose-6-phosphate 1-dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q43727G6PD1_ARATH1, ., 1, ., 1, ., 4, 90.73480.92020.3003yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
PLN02640 573 PLN02640, PLN02640, glucose-6-phosphate 1-dehydrog 1e-103
PLN02333 604 PLN02333, PLN02333, glucose-6-phosphate 1-dehydrog 8e-96
pfam00479183 pfam00479, G6PD_N, Glucose-6-phosphate dehydrogena 5e-69
PRK05722 495 PRK05722, PRK05722, glucose-6-phosphate 1-dehydrog 5e-50
PTZ00309 542 PTZ00309, PTZ00309, glucose-6-phosphate 1-dehydrog 1e-48
TIGR00871 482 TIGR00871, zwf, glucose-6-phosphate 1-dehydrogenas 9e-48
COG0364 483 COG0364, Zwf, Glucose-6-phosphate 1-dehydrogenase 9e-45
PLN02539 491 PLN02539, PLN02539, glucose-6-phosphate 1-dehydrog 2e-44
PRK12853 482 PRK12853, PRK12853, glucose-6-phosphate 1-dehydrog 2e-33
PRK12854 484 PRK12854, PRK12854, glucose-6-phosphate 1-dehydrog 1e-20
>gnl|CDD|215344 PLN02640, PLN02640, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information 
 Score =  308 bits (789), Expect = e-103
 Identities = 138/181 (76%), Positives = 151/181 (83%), Gaps = 8/181 (4%)

Query: 7   STVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDM 66
           + VGA GDLAKKKIFPALF L+YED LPE+FTVFGYARTKLTDE++R++IS TLTCRID 
Sbjct: 92  TVVGASGDLAKKKIFPALFALFYEDWLPENFTVFGYARTKLTDEELRDMISSTLTCRIDQ 151

Query: 67  KENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIP 126
           +ENC DKMDQFLKRCFYHSG Y+SEE FAEL+ KLKEKE       A KLSNRLFYLSIP
Sbjct: 152 RENCGDKMDQFLKRCFYHSGQYDSEEDFAELNKKLKEKE-------AGKLSNRLFYLSIP 204

Query: 127 PNIFVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICRFVSHL 186
           PNIFV+V +CASLRA S  GWTRVIVEKPFGRDS SSGELTR LKQYL E QI R + H 
Sbjct: 205 PNIFVDVVRCASLRASSENGWTRVIVEKPFGRDSESSGELTRCLKQYLTEEQIFR-IDHY 263

Query: 187 L 187
           L
Sbjct: 264 L 264

Length = 573
>gnl|CDD|215191 PLN02333, PLN02333, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>gnl|CDD|215937 pfam00479, G6PD_N, Glucose-6-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|235579 PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|240353 PTZ00309, PTZ00309, glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233162 TIGR00871, zwf, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>gnl|CDD|223441 COG0364, Zwf, Glucose-6-phosphate 1-dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178154 PLN02539, PLN02539, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>gnl|CDD|237233 PRK12853, PRK12853, glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237234 PRK12854, PRK12854, glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 188
PF00479183 G6PD_N: Glucose-6-phosphate dehydrogenase, NAD bin 100.0
PLN02333 604 glucose-6-phosphate 1-dehydrogenase 100.0
PRK05722 495 glucose-6-phosphate 1-dehydrogenase; Validated 100.0
PLN02640 573 glucose-6-phosphate 1-dehydrogenase 100.0
COG0364 483 Zwf Glucose-6-phosphate 1-dehydrogenase [Carbohydr 100.0
PLN02539 491 glucose-6-phosphate 1-dehydrogenase 100.0
TIGR00871 482 zwf glucose-6-phosphate 1-dehydrogenase. This is a 100.0
PRK12853 482 glucose-6-phosphate 1-dehydrogenase; Provisional 100.0
PRK12854 484 glucose-6-phosphate 1-dehydrogenase; Provisional 100.0
PTZ00309 542 glucose-6-phosphate 1-dehydrogenase; Provisional 100.0
KOG0563 499 consensus Glucose-6-phosphate 1-dehydrogenase [Car 100.0
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.77
COG0673 342 MviM Predicted dehydrogenases and related proteins 96.72
PRK11579 346 putative oxidoreductase; Provisional 96.57
PRK10206 344 putative oxidoreductase; Provisional 96.51
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 95.99
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 94.48
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 93.63
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 92.31
PRK07454241 short chain dehydrogenase; Provisional 92.0
PRK07326237 short chain dehydrogenase; Provisional 91.64
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 91.49
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.98
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 90.74
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 90.46
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 90.4
PRK10538248 malonic semialdehyde reductase; Provisional 89.56
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 89.55
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.43
PRK06914 280 short chain dehydrogenase; Provisional 89.25
PRK09186256 flagellin modification protein A; Provisional 89.25
PRK07774250 short chain dehydrogenase; Provisional 89.03
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.97
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.97
PRK08251248 short chain dehydrogenase; Provisional 88.44
PRK12827249 short chain dehydrogenase; Provisional 88.23
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 87.99
PRK06124256 gluconate 5-dehydrogenase; Provisional 87.95
PRK06500249 short chain dehydrogenase; Provisional 87.9
PRK07102243 short chain dehydrogenase; Provisional 87.38
PRK07062265 short chain dehydrogenase; Provisional 87.32
PRK12828239 short chain dehydrogenase; Provisional 87.18
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 87.1
PRK07478254 short chain dehydrogenase; Provisional 87.05
PRK08643256 acetoin reductase; Validated 87.03
PRK08265261 short chain dehydrogenase; Provisional 87.01
PRK08213259 gluconate 5-dehydrogenase; Provisional 86.64
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 86.62
PRK08628258 short chain dehydrogenase; Provisional 86.28
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.81
PRK08177225 short chain dehydrogenase; Provisional 85.8
PRK07074257 short chain dehydrogenase; Provisional 85.76
PRK07806248 short chain dehydrogenase; Provisional 85.5
KOG2741 351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 85.5
PRK05993 277 short chain dehydrogenase; Provisional 85.47
PRK08278 273 short chain dehydrogenase; Provisional 85.32
PRK09135249 pteridine reductase; Provisional 85.09
PRK07677252 short chain dehydrogenase; Provisional 85.04
PRK07775 274 short chain dehydrogenase; Provisional 84.89
PRK07825273 short chain dehydrogenase; Provisional 84.86
PRK08264238 short chain dehydrogenase; Validated 84.84
PRK09242257 tropinone reductase; Provisional 84.8
PRK06125259 short chain dehydrogenase; Provisional 84.76
PRK05717255 oxidoreductase; Validated 84.66
CHL00194 317 ycf39 Ycf39; Provisional 84.52
PRK07523255 gluconate 5-dehydrogenase; Provisional 84.48
PRK06482 276 short chain dehydrogenase; Provisional 84.25
PRK05875 276 short chain dehydrogenase; Provisional 84.12
PRK12937245 short chain dehydrogenase; Provisional 84.04
PRK06181 263 short chain dehydrogenase; Provisional 83.86
PRK07890 258 short chain dehydrogenase; Provisional 83.83
PRK05650270 short chain dehydrogenase; Provisional 83.69
PRK07814 263 short chain dehydrogenase; Provisional 83.6
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 83.5
PRK09072 263 short chain dehydrogenase; Provisional 83.34
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 82.94
PRK07067257 sorbitol dehydrogenase; Provisional 82.81
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 82.72
PRK12939250 short chain dehydrogenase; Provisional 82.66
PRK06701290 short chain dehydrogenase; Provisional 82.65
PRK12743256 oxidoreductase; Provisional 82.56
PRK06924251 short chain dehydrogenase; Provisional 82.5
PRK06182273 short chain dehydrogenase; Validated 82.4
PRK06138252 short chain dehydrogenase; Provisional 82.37
PRK06196 315 oxidoreductase; Provisional 82.37
PRK08263 275 short chain dehydrogenase; Provisional 82.37
PRK06172253 short chain dehydrogenase; Provisional 82.34
PRK06949258 short chain dehydrogenase; Provisional 82.29
PRK07832272 short chain dehydrogenase; Provisional 82.25
PRK05866293 short chain dehydrogenase; Provisional 81.99
PRK07069251 short chain dehydrogenase; Validated 81.88
PRK07904253 short chain dehydrogenase; Provisional 81.79
PRK08226263 short chain dehydrogenase; Provisional 81.58
PRK06953222 short chain dehydrogenase; Provisional 81.58
PRK07024257 short chain dehydrogenase; Provisional 81.49
PRK05693 274 short chain dehydrogenase; Provisional 80.87
PRK06101240 short chain dehydrogenase; Provisional 80.78
PRK06198 260 short chain dehydrogenase; Provisional 80.64
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 80.61
PRK07109 334 short chain dehydrogenase; Provisional 80.38
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.09
TIGR02415254 23BDH acetoin reductases. One member of this famil 80.08
>PF00479 G6PD_N: Glucose-6-phosphate dehydrogenase, NAD binding domain; InterPro: IPR022674 Glucose-6-phosphate dehydrogenase (1 Back     alignment and domain information 
Probab=100.00  E-value=8.3e-70  Score=444.84  Aligned_cols=175  Identities=42%  Similarity=0.708  Sum_probs=150.3

Q ss_pred             EEEcCcchhchhhhHHHHHHHHHcCCCCCCcEEEEEeCCCCChHHHHHHHHHHhhhhhcCccccHHHHHHHhhcCceeee
Q 044004            7 STVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMKENCEDKMDQFLKRCFYHSG   86 (188)
Q Consensus         7 vIfGatGDLA~rKL~PAL~~L~~~g~lp~~~~Iig~aR~~~s~~~~~~~v~~~l~~~~~~~~~~~~~~~~F~~~~~Y~~~   86 (188)
                      ||||||||||+|||+||||+|+++|+||++++|||+||+++|+++|++++++++++ ......+++.|++|+++++|+++
T Consensus         1 VifGatGDLA~RKL~PaL~~L~~~g~lp~~~~Iig~~R~~~~~~~f~~~v~~~l~~-~~~~~~~~~~~~~F~~~~~Y~~~   79 (183)
T PF00479_consen    1 VIFGATGDLAKRKLLPALYNLYRDGLLPEDFRIIGVARSDLSDEEFREKVREALKK-FSREEIDEEKWEEFLSRLHYVQG   79 (183)
T ss_dssp             EEETTTSHHHHHTHHHHHHHHHHTTSS-SSEEEEEEESS--SHHCCHHHHHHCCGG--S-CCCSHHHHHHHHTTEEEEE-
T ss_pred             CEeccccHHHHhHHHHHHHHHHHhCCCCCCcEEEEecCCcCCHHHHHHHHHHHHHh-hhccccCHHHHHHHhhccEEEeC
Confidence            89999999999999999999999999999999999999999999999999999998 23346788999999999999999


Q ss_pred             cCCCHhhHHHHHHHHHHhHhhhHhhhhccccceEEEecCCcccHHHHHHHHhhcCCCC--CCCeEEEeecCCCCChhhHH
Q 044004           87 LYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNIFVEVAKCASLRAPST--TGWTRVIVEKPFGRDSVSSG  164 (188)
Q Consensus        87 ~~~~~e~y~~L~~~l~~~~~~~~~~~~~~~~~rifYLAvPP~~f~~v~~~l~~~~~~~--~~~~RiVvEKPFG~Dl~SA~  164 (188)
                      |++++++|.+|++.+.+.+.+     .+...||||||||||++|.+|+++|+.+|+..  .||+|||||||||+||+||+
T Consensus        80 d~~~~~~y~~L~~~l~~~~~~-----~~~~~~rifYLAvPP~~f~~i~~~L~~~~l~~~~~g~~RiVvEKPFG~Dl~SA~  154 (183)
T PF00479_consen   80 DYDDPESYAALKKALEELENK-----YGTEANRIFYLAVPPSLFGPIARNLSEAGLNEEPNGWSRIVVEKPFGRDLESAR  154 (183)
T ss_dssp             -SS-HHHHHHHHHHHHHHHHC-----TTTTSEEEEEE-S-GGGHHHHHHHHHHHT-S-TSSS-EEEEESSTSTSSHHHHH
T ss_pred             CCCCchhHHHHHHHHHHhhhh-----cCCCcceEEEeccCHHHHHHHHHHHHHHhcccccCCceEEEEeCCCCCCHHHHH
Confidence            999999999999999987643     45778999999999999999999999999863  37999999999999999999


Q ss_pred             HHHHHHhhhCCCCCcccccCCCC
Q 044004          165 ELTRSLKQYLRENQICRFVSHLL  187 (188)
Q Consensus       165 ~Ln~~l~~~f~E~qIyRIDHYL~  187 (188)
                      +||+.|+++|+|+|||||||||.
T Consensus       155 ~Ln~~l~~~f~E~qIyRIDHYLG  177 (183)
T PF00479_consen  155 ELNDQLAEYFDEEQIYRIDHYLG  177 (183)
T ss_dssp             HHHHHHCTTS-GGGEEE--GGGG
T ss_pred             HHHHHHHHhCCHHHeeehhhhcc
Confidence            99999999999999999999995

1.1.49 from EC) (G6PDH) is a ubiquitous protein, present in bacteria and all eukaryotic cell types []. The enzyme catalyses the the first step in the pentose pathway, i.e. the conversion of glucose-6-phosphate to gluconolactone 6-phosphate in the presence of NADP, producing NADPH. The ubiquitous expression of the enzyme gives it a major role in the production of NADPH for the many NADPH-mediated reductive processes in all cells []. Deficiency of G6PDH is a common genetic abnormality affecting millions of people worldwide. Many sequence variants, most caused by single point mutations, are known, exhibiting a wide variety of phenotypes []. This entry represents the NAD-binding domain of glucose-6-phosphate dehydrogenase.; GO: 0004345 glucose-6-phosphate dehydrogenase activity, 0050661 NADP binding, 0006006 glucose metabolic process, 0055114 oxidation-reduction process; PDB: 4EM5_C 4E9I_A 2DPG_A 1E77_A 1E7M_A 1H9B_A 1E7Y_A 1DPG_B 1H93_A 1H9A_A ....
>PLN02333 glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>PRK05722 glucose-6-phosphate 1-dehydrogenase; Validated Back     alignment and domain information
>PLN02640 glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>COG0364 Zwf Glucose-6-phosphate 1-dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02539 glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>TIGR00871 zwf glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>PRK12853 glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12854 glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>PTZ00309 glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>KOG0563 consensus Glucose-6-phosphate 1-dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
4e9i_A 541 Glucose-6-P Dehydrogenase (Apo Form) From Trypanoso 9e-29
2bh9_A 489 X-Ray Structure Of A Deletion Variant Of Human Gluc 5e-26
1qki_A 514 X-Ray Structure Of Human Glucose 6-Phosphate Dehydr 6e-26
1e7m_A 485 Active Site Mutant (D177->n) Of Glucose 6-Phosphate 1e-17
2dpg_A 485 Complex Of Inactive Mutant (H240->n) Of Glucose 6-P 1e-17
1h93_A 485 Active Mutant (S215->c) Of Glucose 6-Phosphate Dehy 1e-17
1e77_A 485 Complex Of Active Mutant (Q365->c) Of Glucose 6-Pho 1e-17
1dpg_A 485 Glucose 6-Phosphate Dehydrogenase From Leuconostoc 4e-17
>pdb|4E9I|A Chain A, Glucose-6-P Dehydrogenase (Apo Form) From Trypanosoma Cruzi Length = 541 Back     alignment and structure 
Iteration: 1

 Score =  122 bits (307), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 75/185 (40%), Positives = 105/185 (56%), Gaps = 14/185 (7%)
Query: 8   TVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLT---CRI 64
            +GA GDLAKKK FPALF LY    LP D  + GYAR+  T ED+      TL     R+
Sbjct: 59  VLGASGDLAKKKTFPALFQLYCNGMLPRDVNILGYARS--TMEDVEKWKKDTLAGFFTRL 116
Query: 65  DMKENCEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLS 124
           D +  C   +  FL+R  Y +G Y+ +E FA L+ ++   E  +      K  NRLFYL+
Sbjct: 117 D-ERGCH--VGNFLRRISYMTGSYDRDEDFARLNERILRME--EAFQGPEKGGNRLFYLA 171
Query: 125 IPPNIFVEVAKC---ASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICR 181
           +PP++FV V +     +++ P   GW R+IVEKPFGRD+ +S +L+  LK    E Q+ R
Sbjct: 172 LPPSVFVGVCRGLSKGAMQKPE-LGWVRLIVEKPFGRDTETSEQLSNQLKPLFNERQVFR 230
Query: 182 FVSHL 186
              +L
Sbjct: 231 IDHYL 235
>pdb|2BH9|A Chain A, X-Ray Structure Of A Deletion Variant Of Human Glucose 6- Phosphate Dehydrogenase Complexed With Structural And Coenzyme Nadp Length = 489 Back     alignment and structure
>pdb|1QKI|A Chain A, X-Ray Structure Of Human Glucose 6-Phosphate Dehydrogenase (Variant Canton R459l) Complexed With Structural Nadp+ Length = 514 Back     alignment and structure
>pdb|1E7M|A Chain A, Active Site Mutant (D177->n) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides Length = 485 Back     alignment and structure
>pdb|2DPG|A Chain A, Complex Of Inactive Mutant (H240->n) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides With Nadp+ Length = 485 Back     alignment and structure
>pdb|1H93|A Chain A, Active Mutant (S215->c) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides Length = 485 Back     alignment and structure
>pdb|1E77|A Chain A, Complex Of Active Mutant (Q365->c) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides With Substrate Length = 485 Back     alignment and structure
>pdb|1DPG|A Chain A, Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides Length = 485 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query188
2bh9_A 489 G6PD, glucose-6-phosphate 1-dehydrogenase; oxidore 1e-64
4e9i_A 541 Glucose-6-phosphate 1-dehydrogenase; pentose phosp 5e-62
1dpg_A 485 G6PD, glucose 6-phosphate dehydrogenase; oxidoredu 2e-58
>2bh9_A G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreductase, oxidoreductase (CHOH(D)-NADP), carbohydrate metabolism, glucose metabolism; HET: NAP; 2.5A {Homo sapiens} PDB: 2bhl_A* 1qki_A* Length = 489 Back     alignment and structure
 Score =  205 bits (523), Expect = 1e-64
 Identities = 62/172 (36%), Positives = 90/172 (52%), Gaps = 11/172 (6%)

Query: 10  GALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMKEN 69
           GA GDLAKKKI+P ++ L+ +  LPE+  + GYAR++LT  D+R           +    
Sbjct: 12  GASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKATPE---- 67

Query: 70  CEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNI 129
            + K++ F  R  Y +G Y+    +  L+S +               +NRLFYL++PP +
Sbjct: 68  EKLKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLGSQ-------ANRLFYLALPPTV 120

Query: 130 FVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICR 181
           +  V K       S  GW R+IVEKPFGRD  SS  L+  +    RE+QI R
Sbjct: 121 YEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYR 172
>4e9i_A Glucose-6-phosphate 1-dehydrogenase; pentose phosphate pathway, alpha beta, NAD(P) rossmann-like domain, oxidoreductase; 2.85A {Trypanosoma cruzi} PDB: 4em5_A* Length = 541 Back     alignment and structure
>1dpg_A G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase, NADP/NAD, glucose metabolism, oxidoreductase (CHOH(D) - NAD(P)); 2.00A {Leuconostoc mesenteroides} SCOP: c.2.1.3 d.81.1.5 PDB: 1e7y_A* 1e7m_A* 1h93_A 1h94_A* 1h9a_A* 1e77_A* 1h9b_A 2dpg_A* Length = 485 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
1dpg_A 485 G6PD, glucose 6-phosphate dehydrogenase; oxidoredu 100.0
2bh9_A 489 G6PD, glucose-6-phosphate 1-dehydrogenase; oxidore 100.0
4e9i_A 541 Glucose-6-phosphate 1-dehydrogenase; pentose phosp 100.0
4had_A 350 Probable oxidoreductase protein; structural genomi 97.34
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 97.17
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.11
4h3v_A 390 Oxidoreductase domain protein; structural genomics 97.05
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 96.98
1ydw_A 362 AX110P-like protein; structural genomics, protein 96.93
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 96.92
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 96.91
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 96.91
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 96.88
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 96.87
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.86
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 96.85
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 96.8
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 96.78
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.76
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 96.76
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.71
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 96.71
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 96.7
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 96.67
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 96.66
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.54
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 96.54
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 96.5
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 96.38
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 96.3
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 96.17
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 96.15
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 95.94
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 95.07
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.91
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 94.44
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 94.43
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 94.42
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 94.38
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 94.27
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 94.24
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.22
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 94.21
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 94.15
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 93.92
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 93.83
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.75
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 93.72
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 93.38
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 93.17
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 93.08
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 92.78
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 92.63
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 91.5
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 90.94
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 90.3
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 90.18
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 89.97
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 89.24
1xq6_A253 Unknown protein; structural genomics, protein stru 89.02
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 88.88
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 88.85
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 88.44
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 88.41
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 88.36
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 87.69
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 87.55
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 87.49
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 86.95
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 86.91
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 86.6
4f6c_A 427 AUSA reductase domain protein; thioester reductase 86.41
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 86.34
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 86.29
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 86.24
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 85.99
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 85.58
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 85.25
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 85.01
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 84.93
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 84.77
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 84.25
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 84.22
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 84.11
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 84.08
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 83.97
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 83.96
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 83.83
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 83.73
4f6l_B 508 AUSA reductase domain protein; thioester reductase 83.64
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 83.58
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 83.4
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 83.31
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 83.2
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 82.99
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 82.9
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 82.9
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 82.85
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 82.66
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 82.56
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 82.54
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 82.49
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 82.39
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 82.35
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 82.15
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 81.67
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 81.56
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 81.34
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 81.21
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 81.18
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 81.17
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 81.13
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 81.05
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 80.88
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 80.81
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 80.78
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 80.55
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 80.49
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 80.48
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 80.14
>1dpg_A G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase, NADP/NAD, glucose metabolism, oxidoreductase (CHOH(D) - NAD(P)); 2.00A {Leuconostoc mesenteroides} SCOP: c.2.1.3 d.81.1.5 PDB: 1e7y_A* 1e7m_A* 1h93_A 1h94_A* 1h9a_A* 1e77_A* 1h9b_A 2dpg_A* Back     alignment and structure
Probab=100.00  E-value=2.3e-63  Score=453.83  Aligned_cols=177  Identities=27%  Similarity=0.494  Sum_probs=164.4

Q ss_pred             CCeEEEEEcCcchhchhhhHHHHHHHHHcCCCCCCcEEEEEeCCCCChHHHHHHHHHHhhhhhcCccccHHHHHHHhhcC
Q 044004            2 ASSANSTVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMKENCEDKMDQFLKRC   81 (188)
Q Consensus         2 ~~~~~vIfGatGDLA~rKL~PAL~~L~~~g~lp~~~~Iig~aR~~~s~~~~~~~v~~~l~~~~~~~~~~~~~~~~F~~~~   81 (188)
                      .||++||||||||||+||||||||+|+++|+||++++|||+||+++|+++|++.++++++++.    .+++.|++|++++
T Consensus         4 ~~~~~VIFGatGDLA~RKL~PaLy~L~~~g~Lp~~~~iiG~aR~~~~~~~~r~~~~~~l~~~~----~~~~~~~~F~~~~   79 (485)
T 1dpg_A            4 IKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDCIKDFT----DDQAQAEAFIEHF   79 (485)
T ss_dssp             CCEEEEEETTTSHHHHHTHHHHHHHHHHTTSSCSSEEEEEEESSCCCHHHHHHHHHHHHGGGC----SCHHHHHHHHTTE
T ss_pred             CCeEEEEECCcHHHHHHhHHHHHHHHHhcCCCCCCcEEEEEeCCCCCHHHHHHHHHHHHHhcc----cCHHHHHHHHhcC
Confidence            478999999999999999999999999999999999999999999999999999999998753    2578899999999


Q ss_pred             ceeeecCCCHhhHHHHHHHHHHhHhhhHhhhhccccceEEEecCCcccHHHHHHHHhhcCCCC-CCCeEEEeecCCCCCh
Q 044004           82 FYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNIFVEVAKCASLRAPST-TGWTRVIVEKPFGRDS  160 (188)
Q Consensus        82 ~Y~~~~~~~~e~y~~L~~~l~~~~~~~~~~~~~~~~~rifYLAvPP~~f~~v~~~l~~~~~~~-~~~~RiVvEKPFG~Dl  160 (188)
                      +|+++|++++++|.+|++.|.+.+.+     .++..||+|||||||++|.+||++|+.+|+.. .||+|||||||||+||
T Consensus        80 ~Y~~~d~~~~~~~~~L~~~l~~l~~~-----~~~~~nr~fYLA~pP~~f~~i~~~L~~~gl~~~~g~~RvViEKPFG~DL  154 (485)
T 1dpg_A           80 SYRAHDVTDAASYAVLKEAIEEAADK-----FDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSY  154 (485)
T ss_dssp             EEEECCTTCTTHHHHHHHHHHHHHHH-----TTCCSCEEEEECSCGGGHHHHHHHHHHTTCSCSSSCEEEEECSCCCSSH
T ss_pred             EEeccCCCCHHHHHHHHHHHHHhhhh-----ccCCCceEEEEeCCHHHHHHHHHHHHhcCCCCCCCceEEEEeCCCCCch
Confidence            99999999999999999999865532     44567999999999999999999999999854 3699999999999999


Q ss_pred             hhHHHHHHHHhhhCCCCCcccccCCCC
Q 044004          161 VSSGELTRSLKQYLRENQICRFVSHLL  187 (188)
Q Consensus       161 ~SA~~Ln~~l~~~f~E~qIyRIDHYL~  187 (188)
                      +||++||+.|+++|+|+|||||||||.
T Consensus       155 ~SA~~Ln~~l~~~F~E~qIyRIDHYLG  181 (485)
T 1dpg_A          155 DTAAELQNDLENAFDDNQLFRIDHYLG  181 (485)
T ss_dssp             HHHHHHHHHHTTTCCGGGEEECCGGGG
T ss_pred             hhHHHHHHHHHhhCCHHHEeecccccc
Confidence            999999999999999999999999995
>2bh9_A G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreductase, oxidoreductase (CHOH(D)-NADP), carbohydrate metabolism, glucose metabolism; HET: NAP; 2.5A {Homo sapiens} PDB: 2bhl_A* 1qki_A* Back     alignment and structure
>4e9i_A Glucose-6-phosphate 1-dehydrogenase; pentose phosphate pathway, alpha beta, NAD(P) rossmann-like domain, oxidoreductase; 2.85A {Trypanosoma cruzi} PDB: 4em5_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 188
d1qkia1203 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate d 9e-45
d1h9aa1195 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate de 8e-43
>d1qkia1 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 203 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glucose 6-phosphate dehydrogenase, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  145 bits (366), Expect = 9e-45
 Identities = 62/172 (36%), Positives = 90/172 (52%), Gaps = 11/172 (6%)

Query: 10  GALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMKEN 69
           GA GDLAKKKI+P ++ L+ +  LPE+  + GYAR++LT  D+R           +    
Sbjct: 27  GASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKATPE---- 82

Query: 70  CEDKMDQFLKRCFYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNI 129
            + K++ F  R  Y +G Y+    +  L+S +               +NRLFYL++PP +
Sbjct: 83  EKLKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLGSQ-------ANRLFYLALPPTV 135

Query: 130 FVEVAKCASLRAPSTTGWTRVIVEKPFGRDSVSSGELTRSLKQYLRENQICR 181
           +  V K       S  GW R+IVEKPFGRD  SS  L+  +    RE+QI R
Sbjct: 136 YEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYR 187
>d1h9aa1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]} Length = 195 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query188
d1h9aa1195 Glucose 6-phosphate dehydrogenase, N-terminal doma 100.0
d1qkia1203 Glucose 6-phosphate dehydrogenase, N-terminal doma 100.0
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 97.79
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.66
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.32
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.1
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.6
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 95.86
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 95.19
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 91.88
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 88.87
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 87.9
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 87.34
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 83.52
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 83.3
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 82.52
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 82.29
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 81.24
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 80.71
>d1h9aa1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glucose 6-phosphate dehydrogenase, N-terminal domain
species: Leuconostoc mesenteroides [TaxId: 1245]

Probab=100.00  E-value=1.6e-68  Score=437.76  Aligned_cols=177  Identities=28%  Similarity=0.501  Sum_probs=164.2

Q ss_pred             CCeEEEEEcCcchhchhhhHHHHHHHHHcCCCCCCcEEEEEeCCCCChHHHHHHHHHHhhhhhcCccccHHHHHHHhhcC
Q 044004            2 ASSANSTVGALGDLAKKKIFPALFVLYYEDCLPEDFTVFGYARTKLTDEDMRNVISKTLTCRIDMKENCEDKMDQFLKRC   81 (188)
Q Consensus         2 ~~~~~vIfGatGDLA~rKL~PAL~~L~~~g~lp~~~~Iig~aR~~~s~~~~~~~v~~~l~~~~~~~~~~~~~~~~F~~~~   81 (188)
                      .++.+||||||||||+|||+||||+|+++|.||++++|||+||+++++++|++.|++++++...    ++..|+.|++++
T Consensus         4 ~~t~lVIFGaTGDLa~RKL~PAL~~L~~~g~lp~~~~Iig~aR~~~~~e~f~~~v~~~l~~~~~----~~~~~~~~~~~~   79 (195)
T d1h9aa1           4 IKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTD----DQAQAEAFIEHF   79 (195)
T ss_dssp             CCEEEEEETTTSHHHHHTHHHHHHHHHHTTSSCSSEEEEEEESSCCCHHHHHHHHHHHHGGGCS----CHHHHHHHHTTE
T ss_pred             CceEEEEECcccHHHHhHHHHHHHHHHHcCCCCCCCEEEEEECCcCcHHHHHHHHHHHHhhccc----hHhhHHHHhhcc
Confidence            4677999999999999999999999999999999999999999999999999999999987643    567799999999


Q ss_pred             ceeeecCCCHhhHHHHHHHHHHhHhhhHhhhhccccceEEEecCCcccHHHHHHHHhhcCCC-CCCCeEEEeecCCCCCh
Q 044004           82 FYHSGLYNSEEHFAELDSKLKEKECKKMVFWARKLSNRLFYLSIPPNIFVEVAKCASLRAPS-TTGWTRVIVEKPFGRDS  160 (188)
Q Consensus        82 ~Y~~~~~~~~e~y~~L~~~l~~~~~~~~~~~~~~~~~rifYLAvPP~~f~~v~~~l~~~~~~-~~~~~RiVvEKPFG~Dl  160 (188)
                      .|+++|++++++|.+|.+.|.+.+.+     .+...||+|||||||++|++|+++|+.+|+. .++|+|||||||||+|+
T Consensus        80 ~y~~~~~~~~~~~~~l~~~l~~~~~~-----~~~~~~rifYLAvpP~~F~~i~~~L~~~~l~~~~~~~RvVvEKPfG~Dl  154 (195)
T d1h9aa1          80 SYRAHDVTDAASYAVLKEAIEEAADK-----FDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSY  154 (195)
T ss_dssp             EEEECCTTCTTTHHHHHHHHHHHHHH-----HTCCSCEEEEECSCGGGHHHHHHHHHHTTCSCSSSCEEEEECSCSCSSH
T ss_pred             ceeeEeeccHhhHHHHHHHHHHHHhh-----cCCCcceEEEEecCHHHHHHHHHHHHHhhccccCCceEEEEeCCccCCH
Confidence            99999999999999999999876543     4567899999999999999999999998864 35899999999999999


Q ss_pred             hhHHHHHHHHhhhCCCCCcccccCCCC
Q 044004          161 VSSGELTRSLKQYLRENQICRFVSHLL  187 (188)
Q Consensus       161 ~SA~~Ln~~l~~~f~E~qIyRIDHYL~  187 (188)
                      +||++||+.|+++|+|+|||||||||+
T Consensus       155 ~SA~~Ln~~l~~~f~E~qiyRIDHYLG  181 (195)
T d1h9aa1         155 DTAAELQNDLENAFDDNQLFRIDHYLG  181 (195)
T ss_dssp             HHHHHHHHHHTTTCCGGGEEECCTTTT
T ss_pred             HHHHHHHHHHHhhCCHHHeeeeccccC
Confidence            999999999999999999999999996
>d1qkia1 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure