Citrus Sinensis ID: 044007


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MSQASVKAYPVPEDNIVSSSLQTSSSPGPASNPTNSSLLYSVFFLKEKIHQLQSVVTVLVSQGQATESTSIAMANMGSLIQEIIITASSLMVTCQQMSTLPAASISGNNNITANEIFQQQQHVGPNNQERSSGQQGYYFTEAFDTCYGDNNDYVTTHDHNRGMHNNVINSNDNTNITVAENRESFSEIDCDIIELVAGDLLAKYTHYCQVCGKGFKRDANLRMHMRAHGDEYKTTAALTNPLKKNGSSMGNNNESAIKIARKYSCPQEGCRWNKKHAKFQPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEKHCGDLKWQCSCGTTFSRKDKLMGHVALFVGHTPAVNVNSTNMYGQKGAATGTNAIT
ccccccccccccccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHEEEEEcccccccccHHHHcccccccHHHHHcccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEEcccccccccEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHcccEEccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHEEEccccccccccEEEcccccccccHHHHHHHHHccccccccccccccccccccccHHHHHEccccccccEEcccccccccccccccccccccHHHHHHEEEcccccccEcccccccccEcHcHHHHHHHccccccEEEcccccEccccHHHHHHHHHcccccccccHcccccccccccccccccc
msqasvkaypvpednivssslqtssspgpasnptnsslLYSVFFLKEKIHQLQSVVTVLVSQGQATESTSIAMANMGSLIQEIIITASSLMVTCQqmstlpaasisgnnnitANEIFQQqqhvgpnnqerssgqqgyyfteafdtcygdnndyvtthdhnrgmhnnvinsndntnITVAenresfseidCDIIELVAGDLLAKYTHYCQVCgkgfkrdaNLRMHMRAhgdeykttaaltnplkkngssmgnnnESAIKIARkyscpqegcrwnkkhakfqplksmicaknhykrshcpkmyvckrcnrkqfsVLSDLRTHEkhcgdlkwqcscgttfsrkdklMGHVALFvghtpavnvnstnmygqkgaatgtnait
msqasvkaypvpednIVSSSLQTSSSPGPASNPTNSSLLYSVFFLKEKIHQLQSVVTVLVSQGQATESTSIAMANMGSLIQEIIITASSLMVTCQQMSTLPAASISGNNNITANEIFQQQQHVGPNNQERSSGQQGYYFTEAFDTCYGDNNDYVTTHDHNRGMHnnvinsndnTNITVAENRESFSEIDCDIIELVAGDLLAKYTHYCQVCGKGFKRDANLRMHMRAHGDEYKTTAAltnplkkngssmgnnNESAIKIARKYSCPQEGCRWnkkhakfqplkSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEKhcgdlkwqcsCGTTFSRKDKLMGHVALFVGHTPavnvnstnmygqkgaatgtnait
MSQASVKAYPVPEDNIVssslqtssspgpasNPTNSSLLYSVFFLKEKIHqlqsvvtvlvsqgqATESTSIAMANMGSLIQEIIITASSLMVTCQQMSTLPAASISGNNNITANEIFQQQQHVGPNNQERSSGQQGYYFTEAFDTCYGDNNDYVTTHDHNRGMHnnvinsndntnitvAENRESFSEIDCDIIELVAGDLLAKYTHYCQVCGKGFKRDANLRMHMRAHGDEYKTTAALTNPLKKNGSSMGNNNESAIKIARKYSCPQEGCRWNKKHAKFQPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEKHCGDLKWQCSCGTTFSRKDKLMGHVALFVGHTPAVNVNSTNMYGQKGAATGTNAIT
*************************************LLYSVFFLKEKIHQLQSVVTVLVSQGQATESTSIAMANMGSLIQEIIITASSLMVTCQQMSTLPAA********************************GYYFTEAFDTCYGDNNDYVTTHDHNRGMHNNVINSNDNTNITVAENRESFSEIDCDIIELVAGDLLAKYTHYCQVCGKGFKRDANLRMHM*******************************IKIARKYSCPQEGCRWNKKHAKFQPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEKHCGDLKWQCSCGTTFSRKDKLMGHVALFVGHTPAVNVNST****************
*********************************TNSSLLYSVFFLKEKIHQLQSVVT****************ANMGSLIQEII************************************************************************HDHNR********************RESFSEIDCDIIELVAGDLLAKYTHYCQVCGKGFKRDANLRMHMRAHGDEYKTTAALTN******************IARKYSCPQEGCRWNKKHAKFQPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEKHCGDLKWQCSCGTTFSRKDKLMGHVALFVGHTPAVNVNSTNMYGQKGA****NA**
********YPVPEDNIVS***************TNSSLLYSVFFLKEKIHQLQSVVTVLVSQGQATESTSIAMANMGSLIQEIIITASSLMVTCQQMSTLPAASISGNNNITANEIFQQQ*************QQGYYFTEAFDTCYGDNNDYVTTHDHNRGMHNNVINSNDNTNITVAENRESFSEIDCDIIELVAGDLLAKYTHYCQVCGKGFKRDANLRMHMRAHGDEYKTTAALTNPLKKNGSSMGNNNESAIKIARKYSCPQEGCRWNKKHAKFQPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEKHCGDLKWQCSCGTTFSRKDKLMGHVALFVGHTPAVNVNSTNMYGQKGA********
***ASVKAYPVPEDNI**************SNPTNSSLLYSVFFLKEKIHQLQSVVTVLVSQGQATESTSIAMANMGSLIQEIIITASSLMVTCQQMSTLPAA*********************************************************************************F*EIDCDIIELVAGDLLAKYTHYCQVCGKGFKRDANLRMHMRAHGDEYKTTAALTNPLKKNGSSMGNNNESAIKIARKYSCPQEGCRWNKKHAKFQPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEKHCGDLKWQCSCGTTFSRKDKLMGHVALFVGHTPAVNVNSTNM**************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQASVKAYPVPEDNIVSSSLQTSSSPGPASNPTNSSLLYSVFFLKEKIHQLQSVVTVLVSQGQATESTSIAMANMGSLIQEIIITASSLMVTCQQMSTLPAASISGNNNITANEIFQQQQHVGPNNQERSSGQQGYYFTEAFDTCYGDNNDYVTTHDHNRGMHNNVINSNDNTNITVAENRESFSEIDCDIIELVAGDLLAKYTHYCQVCGKGFKRDANLRMHMRAHGDEYKTTAALTNPLKKNGSSMGNNNESAIKIARKYSCPQEGCRWNKKHAKFQPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEKHCGDLKWQCSCGTTFSRKDKLMGHVALFVGHTPAVNVNSTNMYGQKGAATGTNAIT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query378 2.2.26 [Sep-21-2011]
Q9C8N5499 Protein SENSITIVE TO PROT no no 0.838 0.635 0.395 3e-68
Q943I6522 Zinc finger protein STOP1 no no 0.915 0.662 0.388 4e-68
Q2QX40465 Zinc finger protein STAR3 no no 0.814 0.662 0.384 9e-58
Q9ZWA6 506 Zinc finger protein MAGPI no no 0.373 0.278 0.316 8e-21
Q700D2 503 Zinc finger protein JACKD no no 0.399 0.300 0.335 9e-21
Q9FFH3 466 Zinc finger protein NUTCR no no 0.378 0.306 0.319 1e-20
Q8VWG3303 Protein TRANSPARENT TESTA no no 0.378 0.471 0.386 2e-19
Q14588 700 Zinc finger protein 234 O yes no 0.335 0.181 0.295 7e-08
B4F6U4 1173 PR domain zinc finger pro no no 0.404 0.130 0.295 2e-07
Q5RAX9 1117 PR domain zinc finger pro no no 0.335 0.113 0.335 3e-07
>sp|Q9C8N5|STOP1_ARATH Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 OS=Arabidopsis thaliana GN=STOP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  259 bits (661), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 140/354 (39%), Positives = 207/354 (58%), Gaps = 37/354 (10%)

Query: 37  SLLYSVFFLKEKIHQLQSVVTVLVSQGQ---------ATESTSIAMANMGSLIQEIIITA 87
           ++L ++ F+++KIHQLQ +V +LV +G          A +   +   ++ S+I ++I TA
Sbjct: 80  TMLSNLSFMEQKIHQLQDLVHLLVGRGGQLQGRQDELAAQQQQLITTDLTSIIIQLISTA 139

Query: 88  SSLMVTCQQ-MSTLPAASISGNNNITANEIFQQQQHVGPNNQERSS-GQQGYYFTEAFDT 145
            SL+ + +  MST P    +G          ++  +V   +Q  ++ G + +   +    
Sbjct: 140 GSLLPSVKHNMSTAPGP-FTGQPGSAVFPYVREANNVASQSQNNNNCGAREFDLPKP--- 195

Query: 146 CYGDNNDYVTTHDHNRGMHNNVINSNDNTNITVAENRESFSEIDCDIIELVAGDLLAKYT 205
                       D   G   +V+  ++  +    E  E+      +I++L   ++LA +T
Sbjct: 196 ---------VLVDEREG---HVVEEHEMKDEDDVEEGENLPPGSYEILQLEKEEILAPHT 243

Query: 206 HYCQVCGKGFKRDANLRMHMRAHGDEYKTTAALTNPLKKNGSSMGNNNESAIKIARKYSC 265
           H+C +CGKGFKRDANLRMHMR HGDEYKT AAL  P K++         S   + ++YSC
Sbjct: 244 HFCTICGKGFKRDANLRMHMRGHGDEYKTAAALAKPNKESVPG------SEPMLIKRYSC 297

Query: 266 PQEGCRWNKKHAKFQPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEKHCG 325
           P  GC+ NK+H KFQPLK+++C KNHYKR+HC K + C RC+ K+FSV++DL+THEKHCG
Sbjct: 298 PFLGCKRNKEHKKFQPLKTILCVKNHYKRTHCDKSFTCSRCHTKKFSVIADLKTHEKHCG 357

Query: 326 DLKWQCSCGTTFSRKDKLMGHVALFVGHTPAVNVNSTNMYG----QKGAATGTN 375
             KW CSCGTTFSRKDKL GH+ALF GHTPA+ +  T        Q+G++ G N
Sbjct: 358 KNKWLCSCGTTFSRKDKLFGHIALFQGHTPAIPLEETKPSASTSTQRGSSEGGN 411




Probable transcription factor. Plays a critical role in tolerance to major stress factors in acid soils such as proton H(+) and aluminum ion Al(3+). Required for the expression of genes in response to acidic stress (e.g. ALMT1 and MATE), and Al-activated citrate exudation.
Arabidopsis thaliana (taxid: 3702)
>sp|Q943I6|STOP1_ORYSJ Zinc finger protein STOP1 homolog OS=Oryza sativa subsp. japonica GN=Os01g0871200 PE=2 SV=1 Back     alignment and function description
>sp|Q2QX40|ART1_ORYSJ Zinc finger protein STAR3 OS=Oryza sativa subsp. japonica GN=STAR3 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZWA6|MGP_ARATH Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1 Back     alignment and function description
>sp|Q700D2|JKD_ARATH Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1 Back     alignment and function description
>sp|Q9FFH3|NUC_ARATH Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1 Back     alignment and function description
>sp|Q8VWG3|TT1_ARATH Protein TRANSPARENT TESTA 1 OS=Arabidopsis thaliana GN=TT1 PE=2 SV=1 Back     alignment and function description
>sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 Back     alignment and function description
>sp|B4F6U4|PRD10_XENTR PR domain zinc finger protein 10 OS=Xenopus tropicalis GN=prdm10 PE=2 SV=1 Back     alignment and function description
>sp|Q5RAX9|PRD10_PONAB PR domain zinc finger protein 10 OS=Pongo abelii GN=PRDM10 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query378
297734894367 unnamed protein product [Vitis vinifera] 0.791 0.814 0.598 1e-106
225436444423 PREDICTED: protein SENSITIVE TO PROTON R 0.830 0.742 0.581 1e-105
147772174390 hypothetical protein VITISV_006074 [Viti 0.830 0.805 0.581 1e-105
255565483416 hypothetical protein RCOM_0475290 [Ricin 0.880 0.800 0.567 1e-103
356547149411 PREDICTED: protein SENSITIVE TO PROTON R 0.828 0.761 0.516 4e-97
356541958410 PREDICTED: zinc finger protein STOP1 hom 0.846 0.780 0.513 2e-92
449532625381 PREDICTED: protein SENSITIVE TO PROTON R 0.880 0.874 0.519 1e-91
449443590381 PREDICTED: protein SENSITIVE TO PROTON R 0.880 0.874 0.519 1e-91
356541448410 PREDICTED: uncharacterized protein LOC10 0.851 0.785 0.516 3e-88
30688719373 C2H2 and C2HC zinc finger-containing pro 0.783 0.793 0.519 1e-85
>gi|297734894|emb|CBI17128.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/331 (59%), Positives = 238/331 (71%), Gaps = 32/331 (9%)

Query: 37  SLLYSVFFLKEKIHQLQSVVTVLV--SQGQATESTSIAMANMGSLIQEIIITASSLMVTC 94
           SL+YS   LK+K+HQ+QS++++ V  +QGQ  ES ++A+A MG+LIQE+I  ASS+M +C
Sbjct: 44  SLVYSFSILKDKVHQVQSLISIFVPPNQGQP-ESMAMAVAGMGNLIQEVIAAASSMMYSC 102

Query: 95  QQMSTLPAASISGNNNITANEIFQQQQH-------VGPNNQERSSGQQGYYFTEAFDTCY 147
           QQM    A   SG N+    +  +           V    +ER    QG+Y ++     Y
Sbjct: 103 QQMGYGAAPGNSGTNHGLPQQGVELSDGRVCGDTGVVQMGEERG---QGFYSSDQSLDWY 159

Query: 148 GDNNDYVTTHDHNRGMHNNVINSNDNTNITVAENRESFSEIDCDIIELVAGDLLAKYTHY 207
           GDN++   T+DH+R              I V+ N ++F     DI+EL A DLLAKYTHY
Sbjct: 160 GDNHNNSNTNDHSR-------------TIIVSNNDKTF-----DIVELDAEDLLAKYTHY 201

Query: 208 CQVCGKGFKRDANLRMHMRAHGDEYKTTAALTNPLKKNGSSMGNNNESAIKIARKYSCPQ 267
           CQ+CGKGFKRDANLRMHMRAHGDEYK+ AAL+NP K  G  M  N +  IK+ RKYSCPQ
Sbjct: 202 CQICGKGFKRDANLRMHMRAHGDEYKSNAALSNPTKNIGREM-ENKDDLIKLPRKYSCPQ 260

Query: 268 EGCRWNKKHAKFQPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEKHCGDL 327
           EGCRWN+KHAKFQPLKSMIC KNHYKRSHCPKMY+CKRCN+KQFSVLSDLRTHEKHCGDL
Sbjct: 261 EGCRWNRKHAKFQPLKSMICVKNHYKRSHCPKMYICKRCNQKQFSVLSDLRTHEKHCGDL 320

Query: 328 KWQCSCGTTFSRKDKLMGHVALFVGHTPAVN 358
           KW CSCGTTFSRKDKLMGHVALFVGHTPA+N
Sbjct: 321 KWLCSCGTTFSRKDKLMGHVALFVGHTPAIN 351




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225436444|ref|XP_002272574.1| PREDICTED: protein SENSITIVE TO PROTON RHIZOTOXICITY 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147772174|emb|CAN64546.1| hypothetical protein VITISV_006074 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255565483|ref|XP_002523732.1| hypothetical protein RCOM_0475290 [Ricinus communis] gi|223537036|gb|EEF38672.1| hypothetical protein RCOM_0475290 [Ricinus communis] Back     alignment and taxonomy information
>gi|356547149|ref|XP_003541979.1| PREDICTED: protein SENSITIVE TO PROTON RHIZOTOXICITY 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356541958|ref|XP_003539439.1| PREDICTED: zinc finger protein STOP1 homolog [Glycine max] Back     alignment and taxonomy information
>gi|449532625|ref|XP_004173281.1| PREDICTED: protein SENSITIVE TO PROTON RHIZOTOXICITY 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449443590|ref|XP_004139560.1| PREDICTED: protein SENSITIVE TO PROTON RHIZOTOXICITY 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356541448|ref|XP_003539188.1| PREDICTED: uncharacterized protein LOC100802399 [Glycine max] Back     alignment and taxonomy information
>gi|30688719|ref|NP_197680.2| C2H2 and C2HC zinc finger-containing protein [Arabidopsis thaliana] gi|110743777|dbj|BAE99724.1| hypothetical protein [Arabidopsis thaliana] gi|332005711|gb|AED93094.1| C2H2 and C2HC zinc finger-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query378
TAIR|locus:2172701373 AT5G22890 [Arabidopsis thalian 0.796 0.806 0.469 3e-69
UNIPROTKB|Q943I6522 LOC_Os01g65080 "Zinc finger pr 0.804 0.582 0.422 2.4e-60
TAIR|locus:2036303499 STOP1 "AT1G34370" [Arabidopsis 0.502 0.380 0.555 2.7e-59
UNIPROTKB|Q2QX40465 STAR3 "Zinc finger protein STA 0.457 0.372 0.564 4.8e-55
TAIR|locus:2091931412 WIP4 "AT3G20880" [Arabidopsis 0.370 0.339 0.376 2.5e-25
TAIR|locus:2205334302 DOT5 "DEFECTIVELY ORGANIZED TR 0.388 0.486 0.383 3.5e-25
TAIR|locus:2200003337 WIP3 "AT1G08290" [Arabidopsis 0.359 0.403 0.395 7.8e-23
TAIR|locus:2008386303 TT1 "transparent testa 1" [Ara 0.378 0.471 0.386 3.4e-22
TAIR|locus:2008281337 WIP5 "AT1G51220" [Arabidopsis 0.357 0.400 0.382 1.1e-21
TAIR|locus:2076641383 NTT "AT3G57670" [Arabidopsis t 0.351 0.347 0.380 3.1e-21
TAIR|locus:2172701 AT5G22890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 702 (252.2 bits), Expect = 3.0e-69, P = 3.0e-69
 Identities = 153/326 (46%), Positives = 188/326 (57%)

Query:    37 SLLYSVFFLKEKIHXXXXXXXXXXXXXX-ATESTSIAMANMGSL--IQEIIITASSLMVT 93
             SLLY++  L EK+H                 +S+      + ++  + + IITA+S M  
Sbjct:    55 SLLYNLSTLHEKVHQIQSLVSFYMVSTNNINQSSGSTSLAVANIGSLVQEIITAASSM-- 112

Query:    94 CQQMSTLPAASISGNNNITANEIFQQQQHVGPNNQE--RSSGQQGYYFTEAFDTCYG-DN 150
                + T     I  NNN   N      Q V     E  R     G+ F +     +G   
Sbjct:   113 ---LYTCQQLQIGSNNN---NNDIDNDQTVDAMVLEFSRQETDPGHDFVQESTNLFGVQE 166

Query:   151 NDYVTTHDHNRGMHXXXXXXXXXXXXXXAENRESFSEIDCDIIELVAGDLLAKYTHYCQV 210
                ++  D N   +               ++R   S    DI+EL   DLLAKYTHYCQ+
Sbjct:   167 RGQISFPDQNLDWYNTETINPKKD-----KHRSKPSSGSYDILELDVADLLAKYTHYCQI 221

Query:   211 CGKGFKRDANLRMHMRAHGDEYKTTAALTNPLKKNGSSMGNNNESAIKIARKYSCPQEGC 270
             CGKGFKRDANLRMHMRAHGDEYKT  AL +P     +S       ++K    YSCPQ GC
Sbjct:   222 CGKGFKRDANLRMHMRAHGDEYKTREALISP-----TSQDKKGGYSLK-KHYYSCPQHGC 275

Query:   271 RWNKKHAKFQPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEKHCGDLKWQ 330
             RWN++H KFQPLKS+ICAKNHYKRSHCPKMY+C+RC+ K FSVLSDLRTHEKHCGD+KW 
Sbjct:   276 RWNQRHEKFQPLKSVICAKNHYKRSHCPKMYMCRRCSVKHFSVLSDLRTHEKHCGDIKWV 335

Query:   331 CSCGTTFSRKDKLMGHVALFVGHTPA 356
             CSCGT FSRKDKLM HV+LF+GH PA
Sbjct:   336 CSCGTKFSRKDKLMSHVSLFLGHVPA 361




GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0010200 "response to chitin" evidence=IEP
GO:0006826 "iron ion transport" evidence=RCA
GO:0010106 "cellular response to iron ion starvation" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
UNIPROTKB|Q943I6 LOC_Os01g65080 "Zinc finger protein STOP1 homolog" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2036303 STOP1 "AT1G34370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QX40 STAR3 "Zinc finger protein STAR3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2091931 WIP4 "AT3G20880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205334 DOT5 "DEFECTIVELY ORGANIZED TRIBUTARIES 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200003 WIP3 "AT1G08290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008386 TT1 "transparent testa 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008281 WIP5 "AT1G51220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076641 NTT "AT3G57670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 378
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.96
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.89
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.87
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.81
KOG3608467 consensus Zn finger proteins [General function pre 99.79
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.73
KOG3608467 consensus Zn finger proteins [General function pre 99.72
KOG3576267 consensus Ovo and related transcription factors [T 99.66
KOG3576267 consensus Ovo and related transcription factors [T 99.6
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.54
PLN03086567 PRLI-interacting factor K; Provisional 99.29
PHA00733128 hypothetical protein 99.03
PLN03086567 PRLI-interacting factor K; Provisional 99.01
PHA0276855 hypothetical protein; Provisional 98.97
PHA00733128 hypothetical protein 98.82
PHA0276855 hypothetical protein; Provisional 98.78
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.71
KOG3993500 consensus Transcription factor (contains Zn finger 98.46
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.42
PHA0061644 hypothetical protein 98.3
KOG3993 500 consensus Transcription factor (contains Zn finger 98.15
PHA0073279 hypothetical protein 98.14
PHA0061644 hypothetical protein 98.06
PHA0073279 hypothetical protein 97.98
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.83
COG5189423 SFP1 Putative transcriptional repressor regulating 97.68
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.62
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.51
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.39
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.27
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.18
COG5189423 SFP1 Putative transcriptional repressor regulating 97.14
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.06
PRK04860160 hypothetical protein; Provisional 96.89
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.85
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.84
smart0035526 ZnF_C2H2 zinc finger. 96.61
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.41
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.41
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.21
smart0035526 ZnF_C2H2 zinc finger. 96.11
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.08
PRK04860160 hypothetical protein; Provisional 96.0
COG5048467 FOG: Zn-finger [General function prediction only] 95.99
COG5048467 FOG: Zn-finger [General function prediction only] 95.97
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.23
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.06
KOG1146 1406 consensus Homeobox protein [General function predi 94.93
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.86
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.62
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 94.32
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.27
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 93.54
KOG1146 1406 consensus Homeobox protein [General function predi 93.1
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.88
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.52
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.27
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 89.88
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 88.77
KOG2893 341 consensus Zn finger protein [General function pred 87.87
KOG2785 390 consensus C2H2-type Zn-finger protein [General fun 86.81
KOG2893 341 consensus Zn finger protein [General function pred 86.53
KOG2785 390 consensus C2H2-type Zn-finger protein [General fun 86.06
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 85.29
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 85.06
COG5236 493 Uncharacterized conserved protein, contains RING Z 84.73
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 84.31
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 83.92
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 81.0
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.96  E-value=1.6e-30  Score=232.94  Aligned_cols=137  Identities=22%  Similarity=0.373  Sum_probs=127.4

Q ss_pred             cCCCCceecccccccccCHHHHHHHHHHhCCCCccccCCCCcccCCCCccccchhhhhcCCCcccCCCCCccccccccCC
Q 044007          200 LLAKYTHYCQVCGKGFKRDANLRMHMRAHGDEYKTTAALTNPLKKNGSSMGNNNESAIKIARKYSCPQEGCRWNKKHAKF  279 (378)
Q Consensus       200 ~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~~~~~C~~c~~~~~~~~~l~~h~~~~h~~~k~~~C~~C~k~F~~~~~~~  279 (378)
                      ......|+|..|||.+.+.++|.+|..+|...                          ...+.+.|++|||.|.+-.+  
T Consensus       125 ~~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~--------------------------~s~ka~~C~~C~K~YvSmpA--  176 (279)
T KOG2462|consen  125 AAKHPRYKCPECGKSYSTSSNLSRHKQTHRSL--------------------------DSKKAFSCKYCGKVYVSMPA--  176 (279)
T ss_pred             cccCCceeccccccccccccccchhhcccccc--------------------------cccccccCCCCCceeeehHH--
Confidence            44567899999999999999999999999765                          11377999999999999999  


Q ss_pred             CcccchhhcccccccccCCCceecCCCCCccCCCHHHHHHHHh-ccCCCCeecc-CCCccCChHHHHHHHHHhcCCCCcc
Q 044007          280 QPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEK-HCGDLKWQCS-CGTTFSRKDKLMGHVALFVGHTPAV  357 (378)
Q Consensus       280 k~~~c~~c~~~H~~~h~~~k~~~C~~C~~k~F~~~~~L~~H~~-H~g~kp~~C~-C~k~F~~~~~L~~H~~~H~~~kpy~  357 (378)
                              ++.|+++|.  -+++|.+|| |.|++.+.|+.|+| |+|||||.|. |+|+|..+++|+.||++|.+.|+|.
T Consensus       177 --------LkMHirTH~--l~c~C~iCG-KaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~q  245 (279)
T KOG2462|consen  177 --------LKMHIRTHT--LPCECGICG-KAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQ  245 (279)
T ss_pred             --------HhhHhhccC--CCccccccc-ccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcccc
Confidence                    999999986  589999999 99999999999999 9999999999 9999999999999999999999999


Q ss_pred             cCcchhccCChhhhhhhh
Q 044007          358 NVNSTNMYGQKGAATGTN  375 (378)
Q Consensus       358 C~~C~k~F~~~~~L~~H~  375 (378)
                      |..|+|.|..++.|.||-
T Consensus       246 C~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  246 CPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             CcchhhHHHHHHHHHHhh
Confidence            999999999999999994



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query378
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-07
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 52.8 bits (125), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 46/159 (28%), Positives = 66/159 (41%), Gaps = 32/159 (20%) Query: 208 CQVCGKGFKRDANLRMHMRAHGDEYKTTAALTNPLKKNGSSMGNNNESAIKIARKYSCPQ 267 C CGK F R +L H R H E P K + + +S + Sbjct: 24 CPECGKSFSRSDHLAEHQRTHTGE--------KPYK------------CPECGKSFSDKK 63 Query: 268 EGCRWNKKHAKFQPLKSMICAKNH--------YKRSHC-PKMYVCKRCNRKQFSVLSDLR 318 + R + H +P K C K+ ++R+H K Y C C K FS L+ LR Sbjct: 64 DLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECG-KSFSQLAHLR 122 Query: 319 THEK-HCGDLKWQC-SCGTTFSRKDKLMGHVALFVGHTP 355 H++ H G+ ++C CG +FSR+D L H G P Sbjct: 123 AHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKP 161

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query378
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 51.0 bits (121), Expect = 5e-07
 Identities = 36/288 (12%), Positives = 71/288 (24%), Gaps = 114/288 (39%)

Query: 45  LKEKIHQLQSVVTVLVSQGQATESTSIAMANMGSLIQEIIITASSLMV-TCQQMSTLPAA 103
           L++ + +L+    VL+  G         +   G          + + +  C         
Sbjct: 140 LRQALLELRPAKNVLI-DG---------VLGSGK---------TWVALDVCLSYKVQCKM 180

Query: 104 S-----ISGNNNITANEIFQQQQ----HVGPNNQERSSGQQGYYFT-------------- 140
                 ++  N  +   + +  Q     + PN   RS                       
Sbjct: 181 DFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKS 240

Query: 141 -------------------EAFD-TCYGDNNDYVTTHDHNRGMHNNVINSNDNTNITVAE 180
                               AF+ +C       +TT         + +++   T+I++  
Sbjct: 241 KPYENCLLVLLNVQNAKAWNAFNLSC----KILLTTRFKQV---TDFLSAATTTHISLDH 293

Query: 181 NRESFSEIDCDIIELVAGDLLAKYTHYCQVCGKGFKRDANLRMHMRAHGDEYKTTAALTN 240
           +  + +  +          LL KY                     R    +       TN
Sbjct: 294 HSMTLTPDE-------VKSLLLKYL------------------DCRP--QDLPREVLTTN 326

Query: 241 PLKKNGSSMGNNNESAIK-IARKYSCPQEGCRWNK-KHAKFQPLKSMI 286
           P               +  IA   S       W+  KH     L ++I
Sbjct: 327 PR-------------RLSIIAE--SIRDGLATWDNWKHVNCDKLTTII 359


>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query378
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.88
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.86
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.83
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.81
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.79
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.78
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.77
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.76
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.76
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.75
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.75
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.75
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.74
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.74
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.72
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.72
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.71
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.7
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.69
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.68
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.68
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.66
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.63
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.63
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.62
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.62
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.62
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.61
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.58
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.57
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.55
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.54
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.53
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.52
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.51
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.51
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.5
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.49
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.49
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.49
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.48
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.47
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.46
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.46
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.46
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.46
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.45
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.44
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.44
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.44
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.44
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.43
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.43
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.41
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.41
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.4
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.39
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.39
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.39
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.39
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.38
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.36
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.36
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.3
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.28
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.27
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.26
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.26
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.26
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.25
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.25
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.25
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.25
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.25
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.24
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.23
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.22
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.22
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.2
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.16
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.15
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.14
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.13
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.13
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.1
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.1
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.1
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.1
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.08
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.08
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.07
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.06
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.03
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.02
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.01
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.0
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.0
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.97
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.96
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.96
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.95
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.95
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.95
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.94
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.92
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.92
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.92
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.91
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.9
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.88
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.87
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.87
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.86
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.86
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.85
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.82
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.81
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.79
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.79
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.78
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.68
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.66
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.66
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.58
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.57
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.55
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.47
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.45
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.41
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.39
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.37
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.34
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.33
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.3
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.28
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.28
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.26
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.24
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.19
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.19
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.19
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.17
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.17
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.14
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.13
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.11
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.1
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.09
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.08
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.08
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.33
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.32
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.04
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.04
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.03
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.03
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.28
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.01
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.99
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.98
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.98
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.95
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.92
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.92
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.9
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.89
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.87
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.87
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.86
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.86
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.07
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.05
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.0
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.73
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.67
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.54
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.41
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.3
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.63
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.61
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.41
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.97
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.86
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.39
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.19
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.37
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 88.77
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 81.44
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 81.12
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=2.2e-35  Score=260.77  Aligned_cols=168  Identities=24%  Similarity=0.474  Sum_probs=144.5

Q ss_pred             ccCCCCceecccccccccCHHHHHHHHHHhCCCCccccCCCCcccCCCCccccchhhhhcCCCcccCCCCCccccccccC
Q 044007          199 DLLAKYTHYCQVCGKGFKRDANLRMHMRAHGDEYKTTAALTNPLKKNGSSMGNNNESAIKIARKYSCPQEGCRWNKKHAK  278 (378)
Q Consensus       199 ~~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~~~~~C~~c~~~~~~~~~l~~h~~~~h~~~k~~~C~~C~k~F~~~~~~  278 (378)
                      ...++++|.|++|++.|.+...|..|++.|.++++|.|..|++.|.....|..| ++.|.++++|.|+.|++.|..... 
T Consensus        15 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H-~~~h~~~~~~~C~~C~~~f~~~~~-   92 (190)
T 2i13_A           15 LEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRH-QRTHTGEKPYKCPECGKSFSQRAN-   92 (190)
T ss_dssp             ----------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHH-HHHHHCCCCEECTTTCCEESCHHH-
T ss_pred             hcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHH-HHhcCCCCCccCcccCCccCCHHH-
Confidence            345678999999999999999999999999999999999999999999999999 567889999999999999999988 


Q ss_pred             CCcccchhhcccccccccCCCceecCCCCCccCCCHHHHHHHHh-ccCCCCeecc-CCCccCChHHHHHHHHHhcCCCCc
Q 044007          279 FQPLKSMICAKNHYKRSHCPKMYVCKRCNRKQFSVLSDLRTHEK-HCGDLKWQCS-CGTTFSRKDKLMGHVALFVGHTPA  356 (378)
Q Consensus       279 ~k~~~c~~c~~~H~~~h~~~k~~~C~~C~~k~F~~~~~L~~H~~-H~g~kp~~C~-C~k~F~~~~~L~~H~~~H~~~kpy  356 (378)
                               +..|++.|+++++|.|+.|+ +.|.....|..|++ |.+++||.|+ |++.|.+...|..|+++|++++||
T Consensus        93 ---------l~~H~~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~  162 (190)
T 2i13_A           93 ---------LRAHQRTHTGEKPYACPECG-KSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPY  162 (190)
T ss_dssp             ---------HHHHHHHHHTCCCEECTTTC-CEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCE
T ss_pred             ---------HHHHHHhcCCCCCCcCCCCC-CccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCe
Confidence                     89999999999999999999 99999999999999 9999999999 999999999999999999999999


Q ss_pred             ccCcchhccCChhhhhhhhcCC
Q 044007          357 VNVNSTNMYGQKGAATGTNAIT  378 (378)
Q Consensus       357 ~C~~C~k~F~~~~~L~~H~rv~  378 (378)
                      .|++|++.|.++..|++|++++
T Consensus       163 ~C~~C~~~f~~~~~L~~H~~~H  184 (190)
T 2i13_A          163 KCPECGKSFSRRDALNVHQRTH  184 (190)
T ss_dssp             ECTTTCCEESSHHHHHHHHTTC
T ss_pred             ECCCCCCccCCHHHHHHHHHhc
Confidence            9999999999999999999975



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 378
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-04
d2dmda226 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {H 4e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.003
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.003
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 35.4 bits (82), Expect = 3e-04
 Identities = 8/26 (30%), Positives = 13/26 (50%)

Query: 206 HYCQVCGKGFKRDANLRMHMRAHGDE 231
           + C  C K F++   L MH + + D 
Sbjct: 9   YACSHCDKTFRQKQLLDMHFKRYHDP 34


>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query378
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.69
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.59
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.2
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.16
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.16
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.07
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.06
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.05
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.05
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.05
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.03
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.99
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.98
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.95
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.94
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.94
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.88
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.87
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.87
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.81
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.75
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.75
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.7
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.69
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.67
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.66
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.65
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.64
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.57
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.55
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.46
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.44
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.41
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.38
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.38
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.37
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.32
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.29
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.26
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.11
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.06
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.04
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.84
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.81
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.79
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.7
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.69
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.58
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.5
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.48
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.48
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.45
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.43
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.39
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.39
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.38
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.27
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.21
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.18
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.17
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.0
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.99
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.98
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.95
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.95
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.89
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.85
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.78
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.76
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.71
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.54
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.29
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.25
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.23
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.21
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.06
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.03
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.02
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.0
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.93
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.76
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.55
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.43
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.38
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.15
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.07
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.93
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.89
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.63
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.44
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.8
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.98
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.86
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.62
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.58
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 92.53
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.69
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.11
d1y0jb136 U-shaped transcription factor, different fingers { 90.68
d1y0jb136 U-shaped transcription factor, different fingers { 88.25
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.99
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 87.69
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.37
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.71
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 84.96
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 84.77
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 84.45
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 82.93
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 81.45
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 81.25
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 81.25
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 80.99
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 80.82
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69  E-value=6.9e-18  Score=115.42  Aligned_cols=53  Identities=23%  Similarity=0.410  Sum_probs=40.7

Q ss_pred             CCCeeccCCCccCChHHHHHHHHHhcCCCCcccCcchhccCChhhhhhhhcCC
Q 044007          326 DLKWQCSCGTTFSRKDKLMGHVALFVGHTPAVNVNSTNMYGQKGAATGTNAIT  378 (378)
Q Consensus       326 ~kp~~C~C~k~F~~~~~L~~H~~~H~~~kpy~C~~C~k~F~~~~~L~~H~rv~  378 (378)
                      ||||.|+||++|.++..|..|+++|+|++||.|.+||+.|.+.+.|.+|+|+|
T Consensus         1 EK~y~C~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECTTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCCCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            56777777777777777777777777777777777777777777777777765



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure