Citrus Sinensis ID: 044020


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560---
MVTAISDYKQSLQFRDLDREKKKIFIQVTRDGQRQKVCTYDLVVGDIVHLSIGDQVPAYGIFISGHSLLIDESSLSGQSEPRYMYEENPFLLAGTKVQGGSGKMLVTTVGMRTEWGKLMETLNEGGEDETPLQVKLNGVATIIGKIELFFSVLEFLVLIGRFLGEKVIHNEFTDWSSADALTLIDYFAVVVTIIDVAVPEGLPLAVTLSLAFAMKKLMNDGALVRHLSACETMGSASCICTDKTRMLTTNHMVVDKIWIANTISNVEGNNRKDILQSEISERVLDITLQAIFQNTGSKVVKDKDGKNSILGTPTESAILEFGLRLGGDFEAQRREFKIVKVEPFNSVRKKMSVLIALPAGGMRAFCKGASEIVLSMCDKVVSDNGEPVPLSEEQFRNITDVINGFASEALRTLCLAFKDLNDSSNENNIPDSGYTLIAVVGIKDPVRPGVKEAVQTCLEAGITVRMVTGDNINTARAIAKECGILTSDGEAVEGPEFRNMSPADIIPKLQVMARSLPSDKHTLVTQLRNTFGEVVAVTGDGTNDASALHEADIGLAMGIAGTE
cccEEccHHHHHHHHHHHHHHccccEEEEEccEEEEEEccccccccEEEEccccCCcccEEEEEEccEEEEccccccccccccccccccEEEEccEEEEccEEEEEEEEccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHEEEEEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEEccEEEEEccccccccccccccHHHHHHHHHHHHHcccccEECccccccEEcccHHHHHHHHHHHHccccHHHHHHHccccEEEcccccccEEEEEEEcccccEEEEEccHHHHHHHHccccccccccEECccHHHHHHHHHHHHHHHHHHHHHHHEEEECcccccccccccccccEEEEEEcccccccccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHcccccccccEEEcHHHHcccccccccccEEEEcccccHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccc
MVTAISDYKQSLQFRD*DREKKKIFIQVTRDGQRQKVCTYDLVVGDIVHLSIGDQVPAYGIFISGHSLLIDESSLSGQSEPRYMYEENPFLLAGTKVQGGSGKMLVTTVGMRTEWGKLMETLNEGG*DETPLQVKLNGVATIIGKIELFFSVLEFLVLIGRFLGEKVIHNEFTDWSSADALTLIDYFAVVVTIIDVAVPEGLPLAVTLSLAFAMKKLMNDGALVRHLSACETMGSASCICTDKTRMLTTNHMVVDKIWIANTISNVEGNNRKDILQSEISERVLDITLQAIFQNTGSKVVKDKDGKNSILGTPTESAILEFGLRLGGDFEAQRREFKIVKVEPFNSVRKKMSVLIALPAGGMRAFCKGASEIVLSMCDKVVSDNGEPVPLSEEQFRNITDVINGFASEALRTLCLAFKDLNDSSNENNIPDSGYTLIAVVGIKDPVRPGVKEAVQTCLEAGITVRMVTGDNINTARAIAKECGILTSDGEAVEGPEFRNMSPADIIPKLQVMARSLPSDKHTLVTQLRNTFGEVVAVTGDGTNDASALHEADIGLAMGIAG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTAISDYKQSLQFRDLDREKKKIFIQVTRDGQRQKVCTYDLVVGDIVHLSIGDQVPAYGIFISGHSLLIDESSLSGQSEPRYMYEENPFLLAGTKVQGGSGKMLVTTVGMRTEWGKLMETLNEGGEDETPLQVKLNGVATIIGKIELFFSVLEFLVLIGRFLGEKVIHNEFTDWSSADALTLIDYFAVVVTIIDVAVPEGLPLAVTLSLAFAMKKLMNDGALVRHLSACETMGSASCICTDKTRMLTTNHMVVDKIWIANTISNVEGNNRKDILQSEISERVLDITLQAIFQNTGSKVVKDKDGKNSILGTPTESAILEFGLRLGGDFEAQRREFKIVKVEPFNSVRKKMSVLIALPAGGMRAFCKGASEIVLSMCDKVVSDNGEPVPLSEEQFRNITDVINGFASEALRTLCLAFKDLNDSSNENNIPDSGYTLIAVVGIKDPVRPGVKEAVQTCLEAGITVRMVTGDNINTARAIAKECGILTSDGEAVEGPEFRNMSPADIIPKLQVMARSLPSDKHTLVTQLRNTFGEVVAVTGDGTNDASALHEADIGLAMGIAGTE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable calcium-transporting ATPase 4, plasma membrane-type This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles.probableQ2QY12
Probable calcium-transporting ATPase 5, plasma membrane-type This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles.probableQ2RAS0
Putative calcium-transporting ATPase 11, plasma membrane-type This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.probableQ9M2L4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.3.-3'-nucleotidase.probable
3.6.3.8Transferred entry: 3.6.3.8.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RFU, chain A
Confidence level:very confident
Coverage over the Query: 2-263,280-295,309-379,390-417,433-486,511-563
View the alignment between query and template
View the model in PyMOL
Template: 3IXZ, chain A
Confidence level:very confident
Coverage over the Query: 2-162,181-563
View the alignment between query and template
View the model in PyMOL