Citrus Sinensis ID: 044062

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------

MLSNRLHGYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKLENENLRELLLRWTCSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLRSCEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEVALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNMRTLTVEEDI

cccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHHcccccccccEEEccccccccccEEEEEccccccccccHHHHHHHHHccccccccccEEEEEccccccccccccccccccccEEEECccccccccccccccccccEEEEcccccEEECcccccccccccccccccEEEccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccEEEEcccccEEEEccccccccccEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccccccEEEECcccccccccHHHHHHHHHHHHcccccccEEEECcccccccccccccccccccEEEECccccccccccccccccccEEEEccccccccccccccccccccccEEEECccccccCCccccccccccEEEEEcccccccccccccc

MLSNRLHGYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKLENENLRELLLRWTCSTDGS**REAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLRSCEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEVALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNMRTLTVE*DI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 7-130,182-276
View the alignment between query and template
View the model in PyMOL

Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 54-140,184-320,350-559
View the alignment between query and template
View the model in PyMOL

Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 55-141,184-318,334-507
View the alignment between query and template
View the model in PyMOL

Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 3-141,156-168,181-275
View the alignment between query and template
View the model in PyMOL

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 1-141,156-169,182-564
View the alignment between query and template
View the model in PyMOL

Template: 3VQ2, chain A
Confidence level:very confident
Coverage over the Query: 1-168,179-534
View the alignment between query and template
View the model in PyMOL