Citrus Sinensis ID: 044062

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------
MLSNRLHGYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKLENENLRELLLRWTCSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLRSCEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEVALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNMRTLTVEEDI
cccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHHcccccccccEEEccccccccccEEEEEcccccccccHHHHHHHHHHccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEcccccEEEEcccccccccccccccccEEEccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccEEEEcccccEEEEccccccccccEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHcccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccEEccccccccccEEEEEcccccccccccccc
ccEEEcccccccccccHcccccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccEEEEEcccHcHHHcccHHcccccccEEEEcccccHHcccccccccccccEEcEEEEcccccccHHHHccHHcccccccHcccccccccHEEEccccccccccccccccHHHHHHHccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccEEccHHHcccccccccccccEEEEcccHHHHHcccccccccccccccccEEEEccccHHHcccccccccccEEEEcccccccccccccccccEEEEccccccEEcccccccccccEEEEEccccccccccccccccccccEEEEccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccEEEEcccccHHcccccccccccccEEEEcccccccccccccccccccEEEEcccHHHHcccHHccccccccccEEEEcccccccccccccccccccEEEEcccHHHHcccccccc
mlsnrlhgylALSILPKLFKLQRLRVFSLrgyriselpdsvgdlryLRHLNLSGTEIKTLPESVNKLYNLHTLLLEDCDRLEKLCADmgnltklhhlnnsntysleempvgigkltclqtlsnfvvgkdsglrlpELKLLMHLRGTLEISKLENENLRELLLRWTcstdgsssreaetemgvldmlkphknleqfgicgyggtkfptwlgdssfsnlvtlkfedcgmctvlpsvgqlpslkhltVRGMSRVkrlgsefygddspipfpcleTLRFEVMQEWEdwiphgssegverfpklrELDILRCSKlqgtfpehlPALQMLVIQECKELLVSITSLPALCKLEIDGCKKVVWRSatdhlgsqnsvvcrdtsnqvflagplkpripkleeLEIKNIKNETYIWKSHngllqdicslkrltidscpklqSLVAEEEKDQQQQLCELSCRLeylglrsceglvklpqsslglnslrdieiykcsslvsfpevalpsklRKIRISSCDAlkslpeawmcdtnssleilsikhccsltyiaeaqlplSLKQLVIHNcdnmrtltveedi
mlsnrlhgYLALsilpklfkLQRLRVFSLRgyriselpdsvgdlryLRHLNLSgteiktlpeSVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKLENENLRELLLRWtcstdgsssrEAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLpsvgqlpslkhltVRGMSRVKRLGsefygddspipFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKKVVWRSATDhlgsqnsvvcrdtSNQVflagplkpripklEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLRSCEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEVALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNMRTLTVEEDI
MLSNRLHGYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKlenenlrelllrWTCSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLRSCEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEVALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNMRTLTVEEDI
*****LHGYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKLENENLRELLLRWTCS**************VLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVA*******QQLCELSCRLEYLGLRSCEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEVALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNMRTL******
MLSNRL*GYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKLENENLRELLLRWTCSTDGS**REAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKKVVWRS******SQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLRSCEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEVALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNMRTLTVE*DI
MLSNRLHGYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKLENENLRELLLRWTCS**********TEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLV*********QLCELSCRLEYLGLRSCEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEVALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNMRTLTVEEDI
MLSNRLHGYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKLENENLRELLLRWTCSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLRSCEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEVALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNMRTLT*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSNRLHGYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKLENENLRELLLRWTCSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALCKLEIDGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLRSCEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEVALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNMRTLTVEEDI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query567 2.2.26 [Sep-21-2011]
Q9LRR5 1424 Putative disease resistan yes no 0.934 0.372 0.325 2e-62
Q9LRR41054 Putative disease resistan no no 0.541 0.291 0.382 1e-54
Q7XA39988 Putative disease resistan N/A no 0.756 0.434 0.302 6e-38
Q7XBQ9970 Disease resistance protei N/A no 0.601 0.351 0.341 1e-36
Q7XA42979 Putative disease resistan N/A no 0.548 0.317 0.353 5e-35
Q7XA40992 Putative disease resistan N/A no 0.742 0.424 0.297 1e-34
Q9V780 849 Protein lap1 OS=Drosophil yes no 0.412 0.275 0.291 2e-09
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.391 0.119 0.288 2e-08
A8JAM0 1159 Coiled-coil domain-contai N/A no 0.197 0.096 0.356 2e-08
Q9RBS2 1024 Protein PopC OS=Ralstonia no no 0.523 0.290 0.247 6e-08
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  240 bits (612), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 195/599 (32%), Positives = 287/599 (47%), Gaps = 69/599 (11%)

Query: 16   PKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLLL 75
            P L  L  LR+ SL  Y+I+ LP S+  L+ LR+L+LS T+IK LPE V  L NL TLLL
Sbjct: 567  PLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLL 626

Query: 76   EDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLP 135
             +C  L  L   +  L  L  L+   T  L EMP GI KL  LQ LSNFV+G+ SG  L 
Sbjct: 627  SNCRDLTSLPKSIAELINLRLLDLVGT-PLVEMPPGIKKLRSLQKLSNFVIGRLSGAGLH 685

Query: 136  ELKLLMHLRGTLEISKLENEN---------------LRELLLRWTCS----TDGSSSREA 176
            ELK L HLRGTL IS+L+N                 L  L+L+WT        GS +  A
Sbjct: 686  ELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALA 745

Query: 177  ETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLPSVGQ 236
              +  VL ML+PH +L+ F I  Y G  FP WLGDSSF  + ++    C +C  LP VGQ
Sbjct: 746  CDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQ 805

Query: 237  LPSLKHLTVRGMSRVKRLGSEFY---GDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGV 293
            LPSLK+L++   + ++++G +F+    +   +PF  L+ L+F  M  W++WI     +G+
Sbjct: 806  LPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPELEDGI 865

Query: 294  ERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLV----------------SIT 337
              FP L++L I RC  L+  FPE LP+   + I +C    V                S  
Sbjct: 866  --FPCLQKLIIQRCPSLRKKFPEGLPSSTEVTISDCPLRAVSGGENSFRRSLTNIPESPA 923

Query: 338  SLPALCKLEID---GCKKVVWRSATDHLGSQNSVVCRDTSNQVFLAGPLKPRIPKLEELE 394
            S+P++ + E+    G  K    ++     + +S    D       +    P+  + E+ +
Sbjct: 924  SIPSMSRRELSSPTGNPKSDASTSAQPGFASSSQSNDDNEVTSTSSLSSLPKDRQTEDFD 983

Query: 395  ---------IKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLC 445
                      +  +    I   ++G + DI S    T+       SLV + + +      
Sbjct: 984  QYETQLGSLPQQFEEPAVISARYSGYISDIPS----TLSPYMSRTSLVPDPKNEGSILPG 1039

Query: 446  ELSCRLEYLGLRSCEGLVKLPQSSLGLNSLR------DIEIYKCSSLVSFPEVALPSKLR 499
              S +    G++S    V  P+SS  +   +      D+E  K + +    E  LP  L+
Sbjct: 1040 SSSYQYHQYGIKSS---VPSPRSSEAIKPSQYDDDETDMEYLKVTDISHLME--LPQNLQ 1094

Query: 500  KIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNM 558
             + I SCD L SLPE  + ++  +L  L I  C SL     +  P +LK L I +C  +
Sbjct: 1095 SLHIDSCDGLTSLPEN-LTESYPNLHELLIIACHSLESFPGSHPPTTLKTLYIRDCKKL 1152
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|A8JAM0|CC135_CHLRE Coiled-coil domain-containing protein lobo homolog (Fragment) OS=Chlamydomonas reinhardtii GN=FAP50 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query567
400131587 1388 FB_MR5 [Malus x robusta] 0.922 0.376 0.419 1e-101
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.864 0.344 0.412 1e-100
359495026 2204 PREDICTED: uncharacterized protein LOC10 0.929 0.239 0.404 1e-96
225449649 1418 PREDICTED: putative disease resistance p 0.924 0.369 0.413 1e-96
359495024 1390 PREDICTED: putative disease resistance p 0.929 0.379 0.402 5e-96
147766392 1471 hypothetical protein VITISV_007674 [Viti 0.915 0.352 0.391 1e-95
225450001 1389 PREDICTED: putative disease resistance p 0.959 0.391 0.401 1e-95
147860511 1406 hypothetical protein VITISV_014536 [Viti 0.929 0.374 0.402 1e-95
147799404 1439 hypothetical protein VITISV_009437 [Viti 0.929 0.366 0.391 2e-95
225450032 1436 PREDICTED: putative disease resistance p 0.904 0.357 0.387 4e-95
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
 Score =  375 bits (964), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 247/589 (41%), Positives = 345/589 (58%), Gaps = 66/589 (11%)

Query: 4    NRLHGYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPES 63
            N L   +A  +LPKL   Q LRV S   Y+I+ELPDS+GDLRYLR+L+LS T+I +LP+S
Sbjct: 565  NYLSRQVAFDLLPKL---QYLRVLSFNCYKITELPDSIGDLRYLRYLDLSYTDITSLPKS 621

Query: 64   VNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSN 123
             + LYNL TL+LE C +L+ L  DM NL  L HLNNSN   LE+MP  +G+L  LQ+L+ 
Sbjct: 622  TSTLYNLQTLILEGCSKLKALPIDMSNLVNLRHLNNSNVSLLEDMPPQLGRLVNLQSLTK 681

Query: 124  FVVGKD-----SGLRLPELKLLMHLRGTLEISKLEN---------------ENLRELLLR 163
            FVV        SG+R  EL+ LMHLRGTL IS+LEN               E L  L+L 
Sbjct: 682  FVVSGGGGGDRSGIR--ELEFLMHLRGTLCISRLENVTDVEDAQRANLNCKERLDSLVLE 739

Query: 164  WTCSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFE 223
            W+ S+D       ETE  VLDML+PH  L++  I  Y G +F +W+G   FSN+V ++ E
Sbjct: 740  WSHSSDTR-----ETESAVLDMLQPHTKLKELTIKSYAGKEFSSWVGVPLFSNMVLVRLE 794

Query: 224  DCGMCTVLPSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWED 283
            +C  C  LP +G+LP LK L +RGM+ V+ +G+EFYG+ S +PFP LETL F  MQ W+ 
Sbjct: 795  ECNNCLSLPPLGKLPHLKELYIRGMNAVESVGAEFYGECS-LPFPLLETLEFVDMQHWKV 853

Query: 284  WIPHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVSITSLPALC 343
            W+P  +      FP L+ L + +CSKL+G  PE+L +L  L I +C+ELLVSI +   L 
Sbjct: 854  WLPFQTDHRGSVFPCLKTLLVRKCSKLEGKLPENLDSLASLEIVKCEELLVSIANYKQLR 913

Query: 344  KLEIDGCKKVVWRSATDHLGSQNSVVCRDTSNQVFL-AGPL-KPRIPKLEELEIKNIKNE 401
            +L IDGCK VV  +A        S+   + S    L  G L +  +  + +L+I   +  
Sbjct: 914  QLNIDGCKGVVHTAAKVEFELLESLYLSNISELTSLQTGELCRNGLNMVRDLKINGCEEL 973

Query: 402  TYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEE---EKDQQQQLCELSCRLEYLGLRS 458
            T   K+   LLQ + SL RL I+      SL+ EE   E D+  QL  L C+LE+L L+ 
Sbjct: 974  TSSLKNEAILLQQLISLGRLEIED----NSLLVEELGKEADELLQLQILGCKLEFLKLKK 1029

Query: 459  CEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEVALPSKLRKIRISSCDALKSLPEAWMC 518
            C+ L+KLP+    L+SL+++ I++CSSLVSFP+V LP  L+ I I+ C            
Sbjct: 1030 CKNLLKLPEGLNQLSSLQELRIHECSSLVSFPDVGLPPSLKDIEITECH----------- 1078

Query: 519  DTNSSLEILSIKHCCSLTYIAEAQLPLSLKQLVIHNCDNMRTLTVEEDI 567
                           SL Y A++Q+P +L+++ I +C ++R+L   E +
Sbjct: 1079 ---------------SLIYFAKSQIPQNLRRIQIRDCRSLRSLVDNEAV 1112

Source: Malus x robusta

Species: Malus x robusta

Genus: Malus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|359495026|ref|XP_003634900.1| PREDICTED: uncharacterized protein LOC100854556 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495024|ref|XP_002267933.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766392|emb|CAN67818.1| hypothetical protein VITISV_007674 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450001|ref|XP_002272075.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147860511|emb|CAN79726.1| hypothetical protein VITISV_014536 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147799404|emb|CAN74717.1| hypothetical protein VITISV_009437 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450032|ref|XP_002273051.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query567
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.567 0.226 0.328 1.4e-39
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.550 0.296 0.314 4.2e-35
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.590 0.169 0.278 4.6e-15
UNIPROTKB|O486471802 O48647 "XA1" [Oryza sativa (ta 0.746 0.234 0.243 7.4e-08
TAIR|locus:2163426 1187 TAO1 "target of AVRB operation 0.447 0.213 0.241 1.1e-06
TAIR|locus:21171491201 AT4G19050 [Arabidopsis thalian 0.223 0.105 0.310 7.8e-11
TAIR|locus:2100182 1007 AT3G44400 [Arabidopsis thalian 0.257 0.144 0.298 5.7e-10
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.881 0.321 0.244 5.9e-10
TAIR|locus:2130270 1449 RPP5 "RECOGNITION OF PERONOSPO 0.527 0.206 0.236 2.9e-09
TAIR|locus:2130250 1304 AT4G16920 [Arabidopsis thalian 0.527 0.229 0.236 1.2e-08
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 366 (133.9 bits), Expect = 1.4e-39, Sum P(2) = 1.4e-39
 Identities = 115/350 (32%), Positives = 173/350 (49%)

Query:     2 LSNRLHGYLALSI-------LPKLFK-LQRLRVFSLRGYRISELPDSVGDLRYLRHLNLS 53
             L N L G   LS+       LPK  K L+ LR   L   +I ELP+ V  L  L+ L LS
Sbjct:   568 LLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLS 627

Query:    54 GT-EIKTLPESVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGI 112
                ++ +LP+S+ +L NL  L L     +E      G + KL  L   + + +  +  G 
Sbjct:   628 NCRDLTSLPKSIAELINLRLLDLVGTPLVEM---PPG-IKKLRSLQKLSNFVIGRLS-GA 682

Query:   113 GKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKXXXXXXXXXXXXWTCS----T 168
             G L  L+ LS+        LR+ EL+ +       +               WT       
Sbjct:   683 G-LHELKELSHL----RGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFV 737

Query:   169 DGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMC 228
              GS +  A  +  VL ML+PH +L+ F I  Y G  FP WLGDSSF  + ++    C +C
Sbjct:   738 PGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLC 797

Query:   229 TVLPSVGQLPSLKHLTVRGMSRVKRLGSEFY-GDDSP--IPFPCLETLRFEVMQEWEDWI 285
               LP VGQLPSLK+L++   + ++++G +F+ G+++   +PF  L+ L+F  M  W++WI
Sbjct:   798 ISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWI 857

Query:   286 PHGSSEGVERFPKLRELDILRCSKLQGTFPEHLPALQMLVIQECKELLVS 335
                  +G+  FP L++L I RC  L+  FPE LP+   + I +C    VS
Sbjct:   858 CPELEDGI--FPCLQKLIIQRCPSLRKKFPEGLPSSTEVTISDCPLRAVS 905
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117149 AT4G19050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100182 AT3G44400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130270 RPP5 "RECOGNITION OF PERONOSPORA PARASITICA 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130250 AT4G16920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00008243001
SubName- Full=Chromosome undetermined scaffold_1317, whole genome shotgun sequence; Flags- Fragment; (909 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query567
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.002
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 64.1 bits (156), Expect = 1e-10
 Identities = 93/348 (26%), Positives = 150/348 (43%), Gaps = 56/348 (16%)

Query: 5   RLHGYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTE-IKTLPES 63
           R   Y  L  +P  F+ + L    ++G ++ +L D V  L  LR+++L G++ +K +P+ 
Sbjct: 595 RWDKY-PLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD- 652

Query: 64  VNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSN 123
           ++   NL TL L DC  L +L + +  L KL  L+ S   +LE +P GI     L++L  
Sbjct: 653 LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGIN----LKSLYR 708

Query: 124 FVVGKDSGLR-LPELK-----LLMHLRGTLEI-SKLENENLRELLLRWTCSTDGSSSREA 176
             +   S L+  P++      L +      E  S L  ENL EL+L    S       + 
Sbjct: 709 LNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQP 768

Query: 177 ETEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLG-DSSFSNLVTLK---FEDCGMCTVLP 232
            T +  + ML P  +L +  +     +  P+ +   SS  NL  L+    E+C     LP
Sbjct: 769 LTPL--MTMLSP--SLTRLFL-----SDIPSLVELPSSIQNLHKLEHLEIENCINLETLP 819

Query: 233 SVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLET------LRFEVMQEWEDWIP 286
           +   L SL+ L + G SR++              FP + T      L    ++E   WI 
Sbjct: 820 TGINLESLESLDLSGCSRLR-------------TFPDISTNISDLNLSRTGIEEVPWWI- 865

Query: 287 HGSSEGVERFPKLRELDILRCSKLQGTFPE--HLPALQMLVIQECKEL 332
                  E+F  L  LD+  C+ LQ        L  L+ +   +C  L
Sbjct: 866 -------EKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGAL 906

syringae 6; Provisional. Length = 1153
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 567
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
KOG4237498 consensus Extracellular matrix protein slit, conta 99.61
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.55
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.51
KOG0617264 consensus Ras suppressor protein (contains leucine 99.49
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.44
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.43
KOG4341483 consensus F-box protein containing LRR [General fu 99.43
KOG4237498 consensus Extracellular matrix protein slit, conta 99.4
KOG4341483 consensus F-box protein containing LRR [General fu 99.35
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.35
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.24
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.16
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.84
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.82
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.75
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.69
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.65
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.59
PLN03150623 hypothetical protein; Provisional 98.58
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.54
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.53
PRK15386 426 type III secretion protein GogB; Provisional 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.46
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.44
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.37
PRK15386 426 type III secretion protein GogB; Provisional 98.35
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.34
PLN03150623 hypothetical protein; Provisional 98.28
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.17
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.17
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.12
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.08
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.06
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.01
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.0
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.96
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.8
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.77
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.6
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.5
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.43
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.24
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.03
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.03
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.95
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.7
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.66
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.27
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.14
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.0
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.83
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.36
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.1
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.97
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.49
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.31
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.81
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.45
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.23
smart0037026 LRR Leucine-rich repeats, outliers. 88.9
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.9
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 87.7
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.3
smart0037026 LRR Leucine-rich repeats, outliers. 85.3
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.3e-37  Score=346.29  Aligned_cols=497  Identities=19%  Similarity=0.177  Sum_probs=282.4

Q ss_pred             CCccccccchhhhhhhhhhccccceEEEecCCCCC-cccccc-ccccccceeeccCCCcc-cccHHHHccccCceeeccC
Q 044062            1 MLSNRLHGYLALSILPKLFKLQRLRVFSLRGYRIS-ELPDSV-GDLRYLRHLNLSGTEIK-TLPESVNKLYNLHTLLLED   77 (567)
Q Consensus         1 l~~n~l~~~~~~~~~~~~~~l~~L~~L~L~~~~~~-~l~~~~-~~l~~L~~L~L~~~~l~-~lp~~~~~l~~L~~L~L~~   77 (567)
                      |++|+++|    .+++.|..+++|++|++++|+++ .+|..+ ..+++|++|++++|.++ .+|.  +.+++|++|++++
T Consensus        76 L~~~~i~~----~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~  149 (968)
T PLN00113         76 LSGKNISG----KISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSN  149 (968)
T ss_pred             ecCCCccc----cCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcC
Confidence            46777887    66778899999999999999887 677654 58899999999988886 3443  4678888888888


Q ss_pred             ccchhhcccccccccccceeeccCccccccccccccccccccccCceEeccCCCCCccccccccccccceeecccccccc
Q 044062           78 CDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKLENENL  157 (567)
Q Consensus        78 ~~~~~~l~~~~~~l~~L~~L~l~~~~~~~~lp~~~~~l~~L~~L~~~~~~~~~~~~~~~l~~l~~l~~~~~~~~~~~~~L  157 (567)
                      |.....+|..++.+++|++|++++|.....+|..+.++++|+.|++..+... ...+..+++++              +|
T Consensus       150 n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~-~~~p~~l~~l~--------------~L  214 (968)
T PLN00113        150 NMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLV-GQIPRELGQMK--------------SL  214 (968)
T ss_pred             CcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCc-CcCChHHcCcC--------------Cc
Confidence            8444567777888888888888888444577777888888888877655321 22334455555              66


Q ss_pred             cceEEEeeecCCCCCCccchhhhhhhccCCCCCCCcEEEEeecCCC-CCcccccCCCCCccceEEEecCCCcccCC-CCC
Q 044062          158 RELLLRWTCSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGT-KFPTWLGDSSFSNLVTLKFEDCGMCTVLP-SVG  235 (567)
Q Consensus       158 ~~l~l~~~~~~~~~~~~~~~~~~~~l~~l~~~~~L~~L~l~~~~~~-~~~~~~~~~~~~~L~~L~l~~~~~~~~~~-~~~  235 (567)
                      +.|++++|....           .....+..+++|++|++.++... .+|..+.  .+++|+.|++++|.+.+..| .+.
T Consensus       215 ~~L~L~~n~l~~-----------~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~--~l~~L~~L~L~~n~l~~~~p~~l~  281 (968)
T PLN00113        215 KWIYLGYNNLSG-----------EIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG--NLKNLQYLFLYQNKLSGPIPPSIF  281 (968)
T ss_pred             cEEECcCCccCC-----------cCChhHhcCCCCCEEECcCceeccccChhHh--CCCCCCEEECcCCeeeccCchhHh
Confidence            666666542211           11223445566777777666543 3344444  46667777777666555554 355


Q ss_pred             CCCCCcEEEEeCCcceeeecccccCCCCCCCCCCcceeeecccccccccccCCCCCcccCCCCccEEEEcCCCCcccCCC
Q 044062          236 QLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFP  315 (567)
Q Consensus       236 ~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~  315 (567)
                      .+++|++|++++|......+..+.      .+++|+.|+++++.....     .+..+..+++|+.|++++| .+.+.+|
T Consensus       282 ~l~~L~~L~Ls~n~l~~~~p~~~~------~l~~L~~L~l~~n~~~~~-----~~~~~~~l~~L~~L~L~~n-~l~~~~p  349 (968)
T PLN00113        282 SLQKLISLDLSDNSLSGEIPELVI------QLQNLEILHLFSNNFTGK-----IPVALTSLPRLQVLQLWSN-KFSGEIP  349 (968)
T ss_pred             hccCcCEEECcCCeeccCCChhHc------CCCCCcEEECCCCccCCc-----CChhHhcCCCCCEEECcCC-CCcCcCC
Confidence            666777777766643333332221      256666666665432111     1122245666666666663 4444444


Q ss_pred             C---CCCcccEEEEecchh---hhhhcCCCCCcceEEecCCCCccc----cccCCCCCcccccccCCCccccccCCCCCC
Q 044062          316 E---HLPALQMLVIQECKE---LLVSITSLPALCKLEIDGCKKVVW----RSATDHLGSQNSVVCRDTSNQVFLAGPLKP  385 (567)
Q Consensus       316 ~---~l~~L~~L~i~~~~~---l~~~~~~~~~L~~L~l~~~~~~~~----~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~  385 (567)
                      .   .+++|+.|++++|..   +...+..+++|+.|++++|.....    ...+++|+.|++.+|......+    ..+.
T Consensus       350 ~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p----~~~~  425 (968)
T PLN00113        350 KNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELP----SEFT  425 (968)
T ss_pred             hHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECC----hhHh
Confidence            3   345666666666542   223334455666666666654332    3445566666666665444333    3344


Q ss_pred             CCCCcCeEEEccCCCccccccccCccccCCCCccEEEEcCCCCccccchhhhhHHHhhhhhccCceeEEEccCCCCCccc
Q 044062          386 RIPKLEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLRSCEGLVKL  465 (567)
Q Consensus       386 ~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~l~~~~~~L~~L~l~~c~~l~~~  465 (567)
                      .+++|+.++++++. +...  ....+ ..+++|++|++++|.....++...      ..    ++|+.|++++|.....+
T Consensus       426 ~l~~L~~L~Ls~N~-l~~~--~~~~~-~~l~~L~~L~L~~n~~~~~~p~~~------~~----~~L~~L~ls~n~l~~~~  491 (968)
T PLN00113        426 KLPLVYFLDISNNN-LQGR--INSRK-WDMPSLQMLSLARNKFFGGLPDSF------GS----KRLENLDLSRNQFSGAV  491 (968)
T ss_pred             cCCCCCEEECcCCc-ccCc--cChhh-ccCCCCcEEECcCceeeeecCccc------cc----ccceEEECcCCccCCcc
Confidence            55666666666654 2222  11122 345566666666544333222211      11    45666666655533344


Q ss_pred             ccCCCCCCCccEEEEccCCCCcccCCc-CCCCCccEEEEccCccccccccccccCCCCCccEEEcccccccccccccCcc
Q 044062          466 PQSSLGLNSLRDIEIYKCSSLVSFPEV-ALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHCCSLTYIAEAQLP  544 (567)
Q Consensus       466 ~~~~~~~~~L~~L~l~~c~~l~~~~~~-~~~~~L~~L~l~~c~~l~~l~~~~~~l~~~~L~~L~l~~c~~l~~~~~~~~~  544 (567)
                      |..+..+++|++|++++|.....+|.. ..+++|+.|++++|.....+|..+..+  ++|++|++++|.....+|..-..
T Consensus       492 ~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l--~~L~~L~Ls~N~l~~~~p~~l~~  569 (968)
T PLN00113        492 PRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEM--PVLSQLDLSQNQLSGEIPKNLGN  569 (968)
T ss_pred             ChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCc--ccCCEEECCCCcccccCChhHhc
Confidence            555555556666666654333333322 224556666665544333455455555  55666666655433333321111


Q ss_pred             -cccCeEEEeeCCCCCccCc
Q 044062          545 -LSLKQLVIHNCDNMRTLTV  563 (567)
Q Consensus       545 -~~L~~l~~~~c~~l~~l~~  563 (567)
                       ++|+++++++|+-...+|.
T Consensus       570 l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        570 VESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             CcccCEEeccCCcceeeCCC
Confidence             4556666665555555554

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query567
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-11
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 91.5 bits (228), Expect = 2e-20
 Identities = 27/111 (24%), Positives = 45/111 (40%)

Query: 12  LSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLH 71
                +   L  L+   L    I  LP S+ +L+ L+ L +  + +  L  +++ L  L 
Sbjct: 173 TDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLE 232

Query: 72  TLLLEDCDRLEKLCADMGNLTKLHHLNNSNTYSLEEMPVGIGKLTCLQTLS 122
            L L  C  L       G    L  L   +  +L  +P+ I +LT L+ L 
Sbjct: 233 ELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLD 283
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query567
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.75
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.75
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.71
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.71
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.7
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.67
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.65
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.64
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.63
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.63
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.63
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.6
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.56
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.54
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.54
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.53
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.48
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.45
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.44
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.44
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.43
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.42
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.41
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.4
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.4
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.39
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.38
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.37
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.36
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.34
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.34
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.33
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.32
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.32
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.32
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.29
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.28
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.27
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.27
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.27
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.22
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.16
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.15
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.13
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.11
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.1
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.1
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.1
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.02
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.02
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.97
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.92
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.78
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.77
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.68
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.67
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.63
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.49
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.44
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.37
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.17
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.14
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.11
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.97
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.9
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.8
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.78
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.61
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.97
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.8
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.75
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.96
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.8e-38  Score=345.48  Aligned_cols=468  Identities=16%  Similarity=0.096  Sum_probs=266.1

Q ss_pred             CCccccccchhhhhhhhhhccccceEEEecCCCCCccccccccccccceeeccCCCcc-cccH--HHHccccCceeeccC
Q 044062            1 MLSNRLHGYLALSILPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIK-TLPE--SVNKLYNLHTLLLED   77 (567)
Q Consensus         1 l~~n~l~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~l~~~~~~l~~L~~L~L~~~~l~-~lp~--~~~~l~~L~~L~L~~   77 (567)
                      |+++++.|. ...+|+.+.++++|+.++++.+.+..+|+.+..+++|++|+|++|.+. .+|.  .++.+++|++|++++
T Consensus        57 L~~~~l~g~-~~~l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~  135 (768)
T 3rgz_A           57 LSSKPLNVG-FSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSS  135 (768)
T ss_dssp             CTTSCCCEE-HHHHHHHTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCS
T ss_pred             CCCCCcCCc-cCccChhHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcC
Confidence            466777771 112788899999999999999988777788999999999999999988 5677  899999999999999


Q ss_pred             ccchhhccccc-ccccccceeeccCccccccc-ccc---ccccccccccCceEeccCCCCCccccccccccccceeeccc
Q 044062           78 CDRLEKLCADM-GNLTKLHHLNNSNTYSLEEM-PVG---IGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKL  152 (567)
Q Consensus        78 ~~~~~~l~~~~-~~l~~L~~L~l~~~~~~~~l-p~~---~~~l~~L~~L~~~~~~~~~~~~~~~l~~l~~l~~~~~~~~~  152 (567)
                      |.....+|..+ +++++|++|++++| .+... |..   +.++++|+.|++..+.......   ...++           
T Consensus       136 n~l~~~~~~~~~~~l~~L~~L~Ls~n-~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~---~~~l~-----------  200 (768)
T 3rgz_A          136 NTLDFPGKVSGGLKLNSLEVLDLSAN-SISGANVVGWVLSDGCGELKHLAISGNKISGDVD---VSRCV-----------  200 (768)
T ss_dssp             SEEECCSSCCSCCCCTTCSEEECCSS-CCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB---CTTCT-----------
T ss_pred             CccCCcCCHHHhccCCCCCEEECCCC-ccCCcCChhhhhhccCCCCCEEECCCCcccccCC---cccCC-----------
Confidence            95445556554 88999999999999 55544 334   7888999999876554322211   23444           


Q ss_pred             ccccccceEEEeeecCCCCCCccchhhhhhhccCCCCCCCcEEEEeecCCCC-CcccccCCCCCccceEEEecCCCcccC
Q 044062          153 ENENLRELLLRWTCSTDGSSSREAETEMGVLDMLKPHKNLEQFGICGYGGTK-FPTWLGDSSFSNLVTLKFEDCGMCTVL  231 (567)
Q Consensus       153 ~~~~L~~l~l~~~~~~~~~~~~~~~~~~~~l~~l~~~~~L~~L~l~~~~~~~-~~~~~~~~~~~~L~~L~l~~~~~~~~~  231 (567)
                         +|+.|++++|....            ..+.+..+++|++|++.++.... ++..+.  .+++|+.|++++|.+.+..
T Consensus       201 ---~L~~L~Ls~n~l~~------------~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~--~l~~L~~L~Ls~n~l~~~~  263 (768)
T 3rgz_A          201 ---NLEFLDVSSNNFST------------GIPFLGDCSALQHLDISGNKLSGDFSRAIS--TCTELKLLNISSNQFVGPI  263 (768)
T ss_dssp             ---TCCEEECCSSCCCS------------CCCBCTTCCSCCEEECCSSCCCSCHHHHTT--TCSSCCEEECCSSCCEESC
T ss_pred             ---cCCEEECcCCcCCC------------CCcccccCCCCCEEECcCCcCCCcccHHHh--cCCCCCEEECCCCcccCcc
Confidence               67777776642211            12225666777777777776653 344444  5777777777777766555


Q ss_pred             CCCCCCCCCcEEEEeCCcceeeecccccCCCCCCCCCCcceeeecccccccccccCCCCCcccCCCCccEEEEcCCCCcc
Q 044062          232 PSVGQLPSLKHLTVRGMSRVKRLGSEFYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQ  311 (567)
Q Consensus       232 ~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~  311 (567)
                      +.. .+++|++|++++|.....++..+...     +++|++|+++++... .    ..+..+..+++|++|++++| .+.
T Consensus       264 ~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~-----~~~L~~L~Ls~n~l~-~----~~p~~~~~l~~L~~L~L~~n-~l~  331 (768)
T 3rgz_A          264 PPL-PLKSLQYLSLAENKFTGEIPDFLSGA-----CDTLTGLDLSGNHFY-G----AVPPFFGSCSLLESLALSSN-NFS  331 (768)
T ss_dssp             CCC-CCTTCCEEECCSSEEEESCCCCSCTT-----CTTCSEEECCSSEEE-E----CCCGGGGGCTTCCEEECCSS-EEE
T ss_pred             Ccc-ccCCCCEEECcCCccCCccCHHHHhh-----cCcCCEEECcCCcCC-C----ccchHHhcCCCccEEECCCC-ccc
Confidence            544 66777777777765443444433221     467777777665321 1    11222355666666666663 444


Q ss_pred             cCCC----CCCCcccEEEEecchh---hhhhcCCCC-CcceEEecCCCCccc----ccc--CCCCCcccccccCCCcccc
Q 044062          312 GTFP----EHLPALQMLVIQECKE---LLVSITSLP-ALCKLEIDGCKKVVW----RSA--TDHLGSQNSVVCRDTSNQV  377 (567)
Q Consensus       312 ~~~~----~~l~~L~~L~i~~~~~---l~~~~~~~~-~L~~L~l~~~~~~~~----~~~--l~~L~~L~l~~~~~~~~~~  377 (567)
                      +.+|    ..+++|++|++++|..   +...+..++ +|++|++++|.....    ...  +++|+.|++++|...+..+
T Consensus       332 ~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p  411 (768)
T 3rgz_A          332 GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP  411 (768)
T ss_dssp             EECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECC
T ss_pred             CcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccC
Confidence            3444    2356666666666642   122222333 556666655544322    111  4455555555554443332


Q ss_pred             ccCCCCCCCCCCcCeEEEccCCCccccccccCccccCCCCccEEEEcCCCCccccchhhhhHHHhhhhhccCceeEEEcc
Q 044062          378 FLAGPLKPRIPKLEELEIKNIKNETYIWKSHNGLLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLR  457 (567)
Q Consensus       378 ~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~l~~~~~~L~~L~l~  457 (567)
                          ..+..+++|+.|++++|. +...  ....+ ..+++|++|++++|. ++......+    ..+    ++|++|+++
T Consensus       412 ----~~l~~l~~L~~L~Ls~N~-l~~~--~p~~l-~~l~~L~~L~L~~n~-l~~~~p~~~----~~l----~~L~~L~L~  474 (768)
T 3rgz_A          412 ----PTLSNCSELVSLHLSFNY-LSGT--IPSSL-GSLSKLRDLKLWLNM-LEGEIPQEL----MYV----KTLETLILD  474 (768)
T ss_dssp             ----GGGGGCTTCCEEECCSSE-EESC--CCGGG-GGCTTCCEEECCSSC-CCSCCCGGG----GGC----TTCCEEECC
T ss_pred             ----HHHhcCCCCCEEECcCCc-ccCc--ccHHH-hcCCCCCEEECCCCc-ccCcCCHHH----cCC----CCceEEEec
Confidence                334445555555555554 2222  12222 444555555555532 221111111    222    455555555


Q ss_pred             CCCCCcccccCCCCCCCccEEEEccCCCCcccCCc-CCCCCccEEEEccCccccccccccccCCCCCccEEEcccc
Q 044062          458 SCEGLVKLPQSSLGLNSLRDIEIYKCSSLVSFPEV-ALPSKLRKIRISSCDALKSLPEAWMCDTNSSLEILSIKHC  532 (567)
Q Consensus       458 ~c~~l~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~-~~~~~L~~L~l~~c~~l~~l~~~~~~l~~~~L~~L~l~~c  532 (567)
                      +|.....+|..+..+++|++|++++|.....+|.. +.+++|+.|++++|.....+|..+..+  ++|++|++++|
T Consensus       475 ~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l--~~L~~L~Ls~N  548 (768)
T 3rgz_A          475 FNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDC--RSLIWLDLNTN  548 (768)
T ss_dssp             SSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGC--TTCCEEECCSS
T ss_pred             CCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCC--CCCCEEECCCC
Confidence            54433344444555555555555554322233322 124455555554443333444444444  45555555544
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 567
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 41.8 bits (97), Expect = 5e-05
 Identities = 26/133 (19%), Positives = 44/133 (33%), Gaps = 4/133 (3%)

Query: 15  LPKLFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLL 74
             +     R R   LRGY+I  + +    L     ++ S  EI+ L      L  L TLL
Sbjct: 11  AAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLD-GFPLLRRLKTLL 69

Query: 75  LEDCDRLEKL--CADMGNLTKLHHLNNSNTYSLEEM-PVGIGKLTCLQTLSNFVVGKDSG 131
           + +                     L N++   L ++ P+   K      +    V     
Sbjct: 70  VNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKH 129

Query: 132 LRLPELKLLMHLR 144
            RL  +  +  +R
Sbjct: 130 YRLYVIYKVPQVR 142
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query567
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.7
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.66
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.59
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.57
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.55
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.47
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.35
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.29
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.29
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.27
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.18
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.01
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.01
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.96
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.82
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.72
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.64
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.94
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.89
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.12
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.61
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.44
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.86  E-value=1.1e-20  Score=187.74  Aligned_cols=339  Identities=19%  Similarity=0.217  Sum_probs=188.8

Q ss_pred             hhccccceEEEecCCCCCccccccccccccceeeccCCCcccccHHHHccccCceeeccCccchhhccccccccccccee
Q 044062           18 LFKLQRLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIKTLPESVNKLYNLHTLLLEDCDRLEKLCADMGNLTKLHHL   97 (567)
Q Consensus        18 ~~~l~~L~~L~L~~~~~~~l~~~~~~l~~L~~L~L~~~~l~~lp~~~~~l~~L~~L~L~~~~~~~~l~~~~~~l~~L~~L   97 (567)
                      ...+.+|++|++++++++.+ +.+..+++|++|++++|+++++|. ++++++|++|++++| .+..++ .++++++|+.|
T Consensus        40 ~~~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n-~i~~i~-~l~~l~~L~~L  115 (384)
T d2omza2          40 QTDLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNN-QIADIT-PLANLTNLTGL  115 (384)
T ss_dssp             HHHHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSS-CCCCCG-GGTTCTTCCEE
T ss_pred             HHHhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCcc-ccCCccccccccccc-cccccc-ccccccccccc
Confidence            34567888999999888877 567888899999999998888864 888899999999988 566664 38888899999


Q ss_pred             eccCccccccccccccccccccccCceEeccCCCCCccccccccccccceeecccccccccceEEEeeecCCCCCCccch
Q 044062           98 NNSNTYSLEEMPVGIGKLTCLQTLSNFVVGKDSGLRLPELKLLMHLRGTLEISKLENENLRELLLRWTCSTDGSSSREAE  177 (567)
Q Consensus        98 ~l~~~~~~~~lp~~~~~l~~L~~L~~~~~~~~~~~~~~~l~~l~~l~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~  177 (567)
                      +++++ ....++.. .....+..............   .....               .......... ..         
T Consensus       116 ~~~~~-~~~~~~~~-~~~~~~~~~~~~~~~l~~~~---~~~~~---------------~~~~~~~~~~-~~---------  165 (384)
T d2omza2         116 TLFNN-QITDIDPL-KNLTNLNRLELSSNTISDIS---ALSGL---------------TSLQQLSFGN-QV---------  165 (384)
T ss_dssp             ECCSS-CCCCCGGG-TTCTTCSEEEEEEEEECCCG---GGTTC---------------TTCSEEEEEE-SC---------
T ss_pred             ccccc-cccccccc-cccccccccccccccccccc---ccccc---------------cccccccccc-cc---------
Confidence            98887 55554432 22233333322211110000   00000               0000000000 00         


Q ss_pred             hhhhhhccCCCCCCCcEEEEeecCCCCCcccccCCCCCccceEEEecCCCcccCCCCCCCCCCcEEEEeCCcceeeeccc
Q 044062          178 TEMGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTVLPSVGQLPSLKHLTVRGMSRVKRLGSE  257 (567)
Q Consensus       178 ~~~~~l~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~  257 (567)
                         .....+.............+..... ....  .+++++.++++++..... ++...+++|++|++++|. +++++. 
T Consensus       166 ---~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~--~l~~~~~l~l~~n~i~~~-~~~~~~~~L~~L~l~~n~-l~~~~~-  236 (384)
T d2omza2         166 ---TDLKPLANLTTLERLDISSNKVSDI-SVLA--KLTNLESLIATNNQISDI-TPLGILTNLDELSLNGNQ-LKDIGT-  236 (384)
T ss_dssp             ---CCCGGGTTCTTCCEEECCSSCCCCC-GGGG--GCTTCSEEECCSSCCCCC-GGGGGCTTCCEEECCSSC-CCCCGG-
T ss_pred             ---chhhhhccccccccccccccccccc-cccc--cccccceeeccCCccCCC-CcccccCCCCEEECCCCC-CCCcch-
Confidence               0001111112222222222211111 1111  355566666666553332 233445566666666653 333321 


Q ss_pred             ccCCCCCCCCCCcceeeecccccccccccCCCCCcccCCCCccEEEEcCCCCcccCCC-CCCCcccEEEEecchhh-hhh
Q 044062          258 FYGDDSPIPFPCLETLRFEVMQEWEDWIPHGSSEGVERFPKLRELDILRCSKLQGTFP-EHLPALQMLVIQECKEL-LVS  335 (567)
Q Consensus       258 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~-~~l~~L~~L~i~~~~~l-~~~  335 (567)
                            +..+++|+.|++.++. +.....      +..+++|++++++++ .+.+..+ ..++.++.+.+..|... ...
T Consensus       237 ------l~~l~~L~~L~l~~n~-l~~~~~------~~~~~~L~~L~l~~~-~l~~~~~~~~~~~l~~l~~~~n~l~~~~~  302 (384)
T d2omza2         237 ------LASLTNLTDLDLANNQ-ISNLAP------LSGLTKLTELKLGAN-QISNISPLAGLTALTNLELNENQLEDISP  302 (384)
T ss_dssp             ------GGGCTTCSEEECCSSC-CCCCGG------GTTCTTCSEEECCSS-CCCCCGGGTTCTTCSEEECCSSCCSCCGG
T ss_pred             ------hhcccccchhccccCc-cCCCCc------ccccccCCEeeccCc-ccCCCCccccccccccccccccccccccc
Confidence                  1225666666666542 222211      245666777777663 4442222 34566666666665421 223


Q ss_pred             cCCCCCcceEEecCCCCccc--cccCCCCCcccccccCCCccccccCCCCCCCCCCcCeEEEccCCCccccccccCcccc
Q 044062          336 ITSLPALCKLEIDGCKKVVW--RSATDHLGSQNSVVCRDTSNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHNGLLQ  413 (567)
Q Consensus       336 ~~~~~~L~~L~l~~~~~~~~--~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~  413 (567)
                      +..+++++.|++++|.....  ...+++|+.|++++|.. +.++     .+..+++|+.|+++++. ++++  +  .+ .
T Consensus       303 ~~~~~~l~~L~ls~n~l~~l~~l~~l~~L~~L~L~~n~l-~~l~-----~l~~l~~L~~L~l~~N~-l~~l--~--~l-~  370 (384)
T d2omza2         303 ISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFANNKV-SDVS-----SLANLTNINWLSAGHNQ-ISDL--T--PL-A  370 (384)
T ss_dssp             GGGCTTCSEEECCSSCCSCCGGGGGCTTCCEEECCSSCC-CCCG-----GGGGCTTCCEEECCSSC-CCBC--G--GG-T
T ss_pred             cchhcccCeEECCCCCCCCCcccccCCCCCEEECCCCCC-CCCh-----hHcCCCCCCEEECCCCc-CCCC--h--hh-c
Confidence            45577788888887765543  56778888888888853 3332     25678899999998886 6655  2  24 6


Q ss_pred             CCCCccEEEEcC
Q 044062          414 DICSLKRLTIDS  425 (567)
Q Consensus       414 ~~~~L~~L~l~~  425 (567)
                      .+++|+.|++++
T Consensus       371 ~l~~L~~L~L~~  382 (384)
T d2omza2         371 NLTRITQLGLND  382 (384)
T ss_dssp             TCTTCSEEECCC
T ss_pred             cCCCCCEeeCCC
Confidence            788999999876
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure