Citrus Sinensis ID: 044095

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MKSHHPKLKTQPRPLFSCGFFCHCTQSVLSPTNSHSPPLPLTPEEPPPPPPPPPPPPPPPHQPESSSSSSSTSQSFTQWKFPLPTSPLHPRFRTDPKPEPDLPPKPLPPPIPFTSLQELFHLAELQLSSGSDSDRLAALYLLERSLLPNPPSDQACQPELMRALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQPDTTQDEMNGCDS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccHHHHHHHccccccHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccc
*************PLFSCGFFCHCTQSV***************************************************************************************LQELFHLAEL**********LAALYLLERSL***********PELMRALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELALQGN******RKGTQLLKSLKE****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSHHPKLKTQPRPLFSCGFFCHCTQSVLSPTNSHSPPLPLTPEEPPPPPPPPPPPPPPPHQPESSSSSSSTSQSFTQWKFPLPTSPLHPRFRTDPKPEPDLPPKPLPPPIPFTSLQELFHLAELQLSSGSDSDRLAALYLLERSLLPNPPSDQACQPELMRALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQPDTTQDEMNGCDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z6H, chain A
Confidence level:confident
Coverage over the Query: 136-296
View the alignment between query and template
View the model in PyMOL
Template: 4HXT, chain A
Confidence level:confident
Coverage over the Query: 116-297
View the alignment between query and template
View the model in PyMOL
Template: 1X9N, chain A
Confidence level:probable
Coverage over the Query: 77-236
View the alignment between query and template
View the model in PyMOL
Template: 3NWA, chain A
Confidence level:probable
Coverage over the Query: 71-106
View the alignment between query and template
View the model in PyMOL