Citrus Sinensis ID: 044095

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MKSHHPKLKTQPRPLFSCGFFCHCTQSVLSPTNSHSPPLPLTPEEPPPPPPPPPPPPPPPHQPESSSSSSSTSQSFTQWKFPLPTSPLHPRFRTDPKPEPDLPPKPLPPPIPFTSLQELFHLAELQLSSGSDSDRLAALYLLERSLLPNPPSDQACQPELMRALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQPDTTQDEMNGCDS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccHHHHHHHHccccccHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccHcccccccc
mkshhpklktqprplfscgffchctqsvlsptnshspplpltpeeppppppppppppppphqpessssssstsqsftqwkfplptsplhprfrtdpkpepdlppkplpppipftslQELFHLAElqlssgsdsDRLAALYLLERsllpnppsdqacqPELMRALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYgggdqlvvaapPEEVARAVELALqgnctprgrrkGTQLLKSLKeygqpdttqdemngcds
mkshhpklktqprplFSCGFFCHCTQSVLSPTNSHSPPLPLTPEEPPPPPPPPPPPPPPPHQPESSSSSSSTSQSFTQWKFPLPTSPLHPRFRTDPKPEPDLPPKPLPPPIPFTSLQELFHLAELQLSSGSDSDRLAALYLLERSLLPNPPSDQACQPELMRALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELalqgnctprgrrkgTQLLKslkeygqpdttqdemngcds
MKSHHPKLKTQPRPLFSCGFFCHCTQSVLSPTNshspplpltpeeppppppppppppppphqpessssssstsqsFTQWKFPLPTSPLHPRFRTdpkpepdlppkplpppipFTSLQELFHLAELQLSSGSDSDrlaalyllersllPNPPSDQACQPELMRALCLAESNRRvaveagavgavievvaeldaaageralaalelMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQlvvaappeevaravelalQGNCTPRGRRKGTQLLKSLKEYGQPDTTQDEMNGCDS
**************LFSCGFFCHCTQSV***************************************************************************************LQELFHLAEL**********LAALYLLERSL************ELMRALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELALQGN**********************************
*************PLFSCGFFCHCTQ******************************************************************************************QELFHLA************LAALYL****************PELMRALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVEL***********RKGTQLLKSLKE****************
*********TQPRPLFSCGFFCHCTQSV*************************************************QWKFPLPTSPLHPRFRTDPKPEPDLPPKPLPPPIPFTSLQELFHLAELQLSSGSDSDRLAALYLLERSLLPNPPSDQACQPELMRALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQP************
**********QPRPLFSCGFFCHCTQSVLSPTNSHSPPLPL**********************************FTQWKFPLPTSP****F*TDPKPEPDLPPKPLPPPIPFTSLQELFHLAELQLSSGSDSDRLAALYLLERSLLPNPPSDQACQPELMRALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYG**************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSHHPKLKTQPRPLFSCGFFCHCTQSVLSPTNSHSPPLPLTPEEPPPPPPPPPPPPPPPHQPESSSSSSSTSQSFTQWKFPLPTSPLHPRFRTDPKPEPDLPPKPLPPPIPFTSLQELFHLAELQLSSGSDSDRLAALYLLERSLLPNPPSDQACQPELMRALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQPDTTQDEMNGCDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
Q9FXA4421 U-box domain-containing p no no 0.561 0.410 0.331 3e-13
Q9LT79421 U-box domain-containing p no no 0.431 0.315 0.328 2e-09
Q0IMG9694 E3 ubiquitin-protein liga no no 0.412 0.182 0.338 2e-07
A2ZLU6694 Protein spotted leaf 11 O N/A no 0.412 0.182 0.338 2e-07
Q9ZV31654 U-box domain-containing p no no 0.415 0.195 0.287 8e-05
>sp|Q9FXA4|PUB26_ARATH U-box domain-containing protein 26 OS=Arabidopsis thaliana GN=PUB26 PE=2 SV=1 Back     alignment and function desciption
 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 92/184 (50%), Gaps = 11/184 (5%)

Query: 127 LSSGSDSDRLAALYLLERSLLPNPPSDQACQP---ELMRALCLAESNRRVAVEAGAVGAV 183
           + SGSDS     L      LL NP S +       + + ALCL +  R +A+ AGA G +
Sbjct: 236 IISGSDSIFEGVL-----DLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGIL 290

Query: 184 IE-VVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAIS 242
           I+ + A+ D    ER LA +EL+C + EG      HAL VP+MV  + +++ R  EYA  
Sbjct: 291 IDRLAADFDRCDTERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAG 350

Query: 243 VLAVIYGGGDQLVVAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQPDTT--Q 300
            L  +    ++    A    +   + L +Q +CT R +RK   LLK L++    D+T   
Sbjct: 351 ALLALCTAEERCRDEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVHS 410

Query: 301 DEMN 304
           D+ N
Sbjct: 411 DDFN 414
Functions as an E3 ubiquitin ligase.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9LT79|PUB25_ARATH U-box domain-containing protein 25 OS=Arabidopsis thaliana GN=PUB25 PE=2 SV=1 Back     alignment and function description
>sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 Back     alignment and function description
>sp|A2ZLU6|SL11_ORYSI Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
449436874324 PREDICTED: U-box domain-containing prote 0.928 0.882 0.611 2e-78
255551014373 conserved hypothetical protein [Ricinus 0.948 0.782 0.595 2e-77
224089042221 predicted protein [Populus trichocarpa] 0.610 0.850 0.652 3e-67
297811271313 hypothetical protein ARALYDRAFT_487992 [ 0.873 0.859 0.520 9e-65
225429983344 PREDICTED: uncharacterized protein LOC10 0.717 0.642 0.558 7e-64
15239082314 ARM repeat-containing protein-like prote 0.876 0.859 0.517 7e-64
356518328307 PREDICTED: uncharacterized protein LOC10 0.889 0.892 0.544 5e-57
358344651289 U-box domain-containing protein [Medicag 0.863 0.920 0.545 1e-55
358344748288 U-box domain-containing protein [Medicag 0.694 0.743 0.585 2e-52
356510011287 PREDICTED: U-box domain-containing prote 0.814 0.874 0.534 1e-50
>gi|449436874|ref|XP_004136217.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus] gi|449534015|ref|XP_004173965.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  298 bits (763), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 195/319 (61%), Positives = 221/319 (69%), Gaps = 33/319 (10%)

Query: 1   MKSHHPKLKTQPRPLFSCGFFCHCTQSVLSPTNSHSPPLPLTPEEPPPPPPPPPPPPPPP 60
           M++H PKLKTQ   LFSCGFF HCT+SVLSPT SHSP LP     P     PPPPP   P
Sbjct: 1   MRTHQPKLKTQ---LFSCGFFRHCTRSVLSPTASHSPALP---SLPSASDQPPPPPSRRP 54

Query: 61  HQPESSSSSSSTSQSFTQWKFPLPTSPL---HPRFRTDPKPEPDLPPKPLPPPIPFTSLQ 117
             P+S SSSSS SQSFTQW+FPLP SP+    P     P      PP PLPPPI  ++L+
Sbjct: 55  PLPDSESSSSSASQSFTQWRFPLPHSPIFTQQPSISDPPSTFSIPPPDPLPPPISASALK 114

Query: 118 ELFHLAELQLSSGSDSDRLAALYLLERSLLPNPPSDQACQPELMR--------------- 162
           E+  +AELQLSS SDSDRLAAL LLERSL+PNP  D  C PELMR               
Sbjct: 115 EILQVAELQLSSASDSDRLAALQLLERSLVPNPSLDSDCTPELMRGLIESFNIKTGSKPA 174

Query: 163 -----ALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRA 217
                ALCLAE NR VAVEAGAVGAVIE + E++ AA ERALA+LELMCTVAEGA E R+
Sbjct: 175 TKILLALCLAEGNRHVAVEAGAVGAVIESLPEMEDAAAERALASLELMCTVAEGAAEVRS 234

Query: 218 HALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGG----DQLVVAAPPEEVARAVELALQG 273
           HAL+VP MVTMMG+MA RGKE AISVL VI+  G     +  V APPEEVARAV LALQG
Sbjct: 235 HALSVPAMVTMMGRMAARGKESAISVLGVIFDSGVSSEAKSGVTAPPEEVARAVVLALQG 294

Query: 274 NCTPRGRRKGTQLLKSLKE 292
           + + RGRRKG +LLK+L+E
Sbjct: 295 DSSVRGRRKGARLLKTLQE 313

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255551014|ref|XP_002516555.1| conserved hypothetical protein [Ricinus communis] gi|223544375|gb|EEF45896.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224089042|ref|XP_002308611.1| predicted protein [Populus trichocarpa] gi|222854587|gb|EEE92134.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297811271|ref|XP_002873519.1| hypothetical protein ARALYDRAFT_487992 [Arabidopsis lyrata subsp. lyrata] gi|297319356|gb|EFH49778.1| hypothetical protein ARALYDRAFT_487992 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225429983|ref|XP_002281453.1| PREDICTED: uncharacterized protein LOC100252675 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15239082|ref|NP_196716.1| ARM repeat-containing protein-like protein [Arabidopsis thaliana] gi|7573412|emb|CAB87715.1| putative protein [Arabidopsis thaliana] gi|27754693|gb|AAO22790.1| unknown protein [Arabidopsis thaliana] gi|28394025|gb|AAO42420.1| unknown protein [Arabidopsis thaliana] gi|332004311|gb|AED91694.1| ARM repeat-containing protein-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356518328|ref|XP_003527831.1| PREDICTED: uncharacterized protein LOC100814020 [Glycine max] Back     alignment and taxonomy information
>gi|358344651|ref|XP_003636401.1| U-box domain-containing protein [Medicago truncatula] gi|355502336|gb|AES83539.1| U-box domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|358344748|ref|XP_003636449.1| U-box domain-containing protein [Medicago truncatula] gi|355502384|gb|AES83587.1| U-box domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356510011|ref|XP_003523734.1| PREDICTED: U-box domain-containing protein 26-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
TAIR|locus:2144261314 AT5G11550 [Arabidopsis thalian 0.464 0.455 0.395 1.8e-46
TAIR|locus:2012136421 PUB26 "plant U-box 26" [Arabid 0.324 0.237 0.284 4.5e-05
TAIR|locus:2144261 AT5G11550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 278 (102.9 bits), Expect = 1.8e-46, Sum P(3) = 1.8e-46
 Identities = 59/149 (39%), Positives = 78/149 (52%)

Query:   159 ELMRALCLAESNRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMCTVAEGAEETRAH 218
             +++ ALCLAE NR                                 MCT AEGA E RAH
Sbjct:   164 KILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERALAALELMCTTAEGAAEVRAH 223

Query:   219 ALAVPVMVTMMGQMAGRGKEYAISVLAVIYG----GGD--QXXXXXXXXXXXXXXXXXXQ 272
             A+ VP MV +M ++AGRG+EYAIS+L+V+YG    GGD  +                  +
Sbjct:   224 AMTVPAMVAVMARLAGRGREYAISILSVVYGKGGEGGDSGEEIAVAPAEEVARAVALALE 283

Query:   273 GNCTPRGRRKGTQLLKSLKEYGQPDTTQD 301
             G CT RG+RKG QLLK+L+EYG+ D +Q+
Sbjct:   284 GECTARGKRKGAQLLKTLEEYGRLDLSQN 312
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2012136 PUB26 "plant U-box 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032452001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (280 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
pfam04652315 pfam04652, DUF605, Vta1 like 1e-06
pfam03276 582 pfam03276, Gag_spuma, Spumavirus gag protein 1e-05
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-05
pfam01213313 pfam01213, CAP_N, Adenylate cyclase associated (CA 4e-05
pfam04652315 pfam04652, DUF605, Vta1 like 9e-05
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 9e-05
pfam05308248 pfam05308, Mito_fiss_reg, Mitochondrial fission re 1e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
TIGR02031589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase s 3e-04
TIGR02031589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase s 6e-04
pfam04652315 pfam04652, DUF605, Vta1 like 0.001
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PRK13406584 PRK13406, bchD, magnesium chelatase subunit D; Pro 0.001
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 0.001
PRK10153 517 PRK10153, PRK10153, DNA-binding transcriptional ac 0.001
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 0.002
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.002
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 0.002
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.003
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
TIGR02031589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase s 0.004
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information 
 Score = 48.9 bits (117), Expect = 1e-06
 Identities = 17/83 (20%), Positives = 20/83 (24%), Gaps = 1/83 (1%)

Query: 30  SPTNSHSPPLPLTPEEPPPPPPPPPPPPPPPHQPESSSSSSSTSQSFTQWKFPLPTSPLH 89
           S     S P P      P     PP P          S  S T+ S        P  P+ 
Sbjct: 190 SSPGVPSFPSPPEDPSSPSDSSLPPAPSSFQSDTPPPSPESPTNPSPPPGPAAPPPPPVQ 249

Query: 90  PRFRTDPKPEPDLPPKPLPPPIP 112
                    +P  P     P   
Sbjct: 250 QVPPL-STAKPTPPSASATPAPI 271

Vta1 (VPS20-associated protein 1) is a positive regulator of Vps4. Vps4 is an ATPase that is required in the multivesicular body (MVB) sorting pathway to dissociate the endosomal sorting complex required for transport (ESCRT). Vta1 promotes correct assembly of Vps4 and stimulates its ATPase activity through its conserved Vta1/SBP1/LIP5 region. Length = 315
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|216368 pfam01213, CAP_N, Adenylate cyclase associated (CAP) N terminal Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|218549 pfam05308, Mito_fiss_reg, Mitochondrial fission regulator Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information
>gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236658 PRK10153, PRK10153, DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.73
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.51
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 99.3
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.18
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 99.13
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.09
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.08
PF05804 708 KAP: Kinesin-associated protein (KAP) 98.99
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.56
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 98.46
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.43
KOG4199461 consensus Uncharacterized conserved protein [Funct 98.26
PF05536 543 Neurochondrin: Neurochondrin 98.24
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 98.16
KOG4199461 consensus Uncharacterized conserved protein [Funct 97.9
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 97.89
KOG1048 717 consensus Neural adherens junction protein Plakoph 97.79
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 97.78
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.74
KOG1048 717 consensus Neural adherens junction protein Plakoph 97.66
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 97.53
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.53
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 97.41
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 97.29
KOG4646173 consensus Uncharacterized conserved protein, conta 97.17
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 97.13
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.08
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 97.08
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 96.96
PF05536 543 Neurochondrin: Neurochondrin 96.93
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 96.84
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.55
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 96.42
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 96.41
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 96.11
cd00256 429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 96.07
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 95.94
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 95.68
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 95.26
PRK09687280 putative lyase; Provisional 95.24
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 95.04
PF11841160 DUF3361: Domain of unknown function (DUF3361) 94.72
KOG4646173 consensus Uncharacterized conserved protein, conta 94.15
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 93.79
KOG1293 678 consensus Proteins containing armadillo/beta-caten 93.39
PRK09687280 putative lyase; Provisional 93.26
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 93.25
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 92.79
KOG2734 536 consensus Uncharacterized conserved protein [Funct 92.55
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 91.74
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 91.6
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 91.3
KOG1293678 consensus Proteins containing armadillo/beta-caten 91.2
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 90.92
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 90.39
KOG3036293 consensus Protein involved in cell differentiation 90.19
PF11841160 DUF3361: Domain of unknown function (DUF3361) 89.91
cd00256 429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 89.78
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 89.49
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 89.38
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 87.63
TIGR02270 410 conserved hypothetical protein. Members are found 86.43
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 86.31
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 86.04
PF08045257 CDC14: Cell division control protein 14, SIN compo 86.04
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 85.89
PF14664 371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 84.65
KOG2973 353 consensus Uncharacterized conserved protein [Funct 84.35
PF14664 371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 83.81
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 82.98
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 82.5
KOG3036293 consensus Protein involved in cell differentiation 82.36
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 82.32
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 80.88
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 80.1
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information 
Probab=99.73  E-value=3.3e-17  Score=184.69  Aligned_cols=166  Identities=20%  Similarity=0.158  Sum_probs=134.1

Q ss_pred             ccCCCCcccchHHHHHHHhCCCCCCCCCcH-----H--HH----------------HHHhcC----CCCcHHHHHHhCcH
Q 044095          128 SSGSDSDRLAALYLLERSLLPNPPSDQACQ-----P--EL----------------MRALCL----AESNRRVAVEAGAV  180 (308)
Q Consensus       128 ss~~i~~~~~AI~lLV~LL~~g~~~~k~~a-----~--a~----------------l~aL~~----~~~Nr~~iV~aGAV  180 (308)
                      +.+..+.+.+++..|++|+++... .+...     +  ..                +..||.    +.+||.++|++|+|
T Consensus      1283 ~~~~~~~~~~a~~ALvkL~kd~is-~~a~~~~~~~a~L~~l~~iL~~~~~~~l~~~l~~Lc~~l~~~~~~R~~~v~agaV 1361 (2102)
T PLN03200       1283 NTGSESEQHAAIGALIKLSSGNPS-KALAIADVEGNALENLCKILSSDSSLELKEDAAELCRVLFTNTRIRSTPAAARCI 1361 (2102)
T ss_pred             cccchhhhHHHHHHHHHHHcCCCC-hHhHhhcccchhHHHHHHhcccccchhHHHHHHHHhHHhcCChHHHhhHHHhCCH
Confidence            444445556777777777776532 11111     1  11                344563    34889999999999


Q ss_pred             HHHHHHHhccChhHHHHHHHHHHHHhcChhhHHHHHhccCcHHHHHHHhcCCCHHHHHHHHHHHHHHhcCCcchhhccCC
Q 044095          181 GAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPP  260 (308)
Q Consensus       181 p~LVeLL~~~s~~~~E~ALAiL~~La~~~eGr~aI~~~~gaIp~LV~lLr~gS~~~KE~AVa~L~sLC~~~~~~v~~a~~  260 (308)
                      ++||++|.+.....+|.|+++|+.|+.+++||+++.+|+++|+.++ ++.++|....|.||++||.||......+.++++
T Consensus      1362 ~~LIeLL~de~~~~~E~Al~vLd~Lc~~eegre~~~~h~a~vplV~-~ilrvS~~a~E~AV~aL~kl~~~~~~v~~Emv~ 1440 (2102)
T PLN03200       1362 EPLISLLVSESSTAQEAGVCALDRLLDDEQLAELVAAHGAVVPLVG-LVVGTNYVLHEAAISALIKLGKDRPPCKLDMVK 1440 (2102)
T ss_pred             HHHHHHHhccCchHHHHHHHHHHHHhcCHhhHHHHHHcCChhhHHH-HHHcCCHHHHHHHHHHHHHHhCCChHHHHHHHH
Confidence            9999999996566699999999999999999999999998888888 777799999999999999999666667778999


Q ss_pred             ccHHHHHHHHHhCCCCHHHHHHHHHHHHHHHhcCCC
Q 044095          261 EEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQP  296 (308)
Q Consensus       261 ~gv~~Ll~Lllqg~cS~raKrKA~~LLklL~~~~e~  296 (308)
                      .|+...+.+++|. |+.+.|+||++|||+|+.+.+.
T Consensus      1441 ~G~~~kllllLQ~-c~~~lkekAaeLLrlL~~~~~~ 1475 (2102)
T PLN03200       1441 AGIIERVLDILPE-APDSLCSAIAELLRILTNNSSI 1475 (2102)
T ss_pred             hCHHHHHHHHHHc-CCHHHHHHHHHHHHHhccchhh
Confidence            9998777788888 9999999999999999988764

>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-05
1x9n_A 688 DNA ligase I; 5'-adenylated nicked DNA, protein-DN 1e-04
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-04
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 3e-04
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 4e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 4e-04
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 8e-04
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
 Score = 44.0 bits (103), Expect = 3e-05
 Identities = 22/88 (25%), Positives = 31/88 (35%), Gaps = 3/88 (3%)

Query: 30  SPTNSHSPPLPLTPEEPPPP---PPPPPPPPPPPHQPESSSSSSSTSQSFTQWKFPLPTS 86
           S + + +    L    PP     P PPPPP P    P  + +  S  Q   +      T+
Sbjct: 25  SASVTSAASDFLAALHPPVTVPDPAPPPPPAPAAGNPPDTVTGDSVLQRILRGPTGPGTT 84

Query: 87  PLHPRFRTDPKPEPDLPPKPLPPPIPFT 114
            L P  R   +P P+ P    P      
Sbjct: 85  SLAPAVRYGRQPGPEAPASAPPAAGRAV 112
>1x9n_A DNA ligase I; 5'-adenylated nicked DNA, protein-DNA complex, L complex; HET: DNA DOC AMP; 3.00A {Homo sapiens} SCOP: a.235.1.1 b.40.4.6 d.142.2.1 Length = 688 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.7
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.68
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.66
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.64
3nmz_A458 APC variant protein; protein-protein complex, arma 99.63
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.61
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.61
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.61
3nmz_A458 APC variant protein; protein-protein complex, arma 99.6
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.6
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.55
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.53
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.5
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.5
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.5
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.49
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.4
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.39
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.32
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.3
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.29
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.28
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.27
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.26
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.25
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.23
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.22
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.22
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.21
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.21
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.17
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.14
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.14
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 99.13
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.1
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.04
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 99.02
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.95
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.24
3grl_A 651 General vesicular transport factor P115; vesicle t 97.73
3grl_A 651 General vesicular transport factor P115; vesicle t 97.62
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.59
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.51
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.42
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.33
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 96.55
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 96.34
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 96.25
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 95.94
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 95.87
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 95.74
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 95.54
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 95.51
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 94.65
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 94.2
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 93.61
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 93.6
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 93.07
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 92.89
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 92.24
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 91.89
1qgr_A 876 Protein (importin beta subunit); transport recepto 91.75
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 90.75
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 90.4
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 88.14
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 87.61
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 87.11
1qgr_A 876 Protein (importin beta subunit); transport recepto 86.35
3eg5_B 383 Protein diaphanous homolog 1; protein-protein comp 85.37
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 84.82
3b2a_A 265 TON_1937, putative uncharacterized protein; heat-r 84.31
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 82.56
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 82.27
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
Probab=99.70  E-value=9.5e-18  Score=153.18  Aligned_cols=168  Identities=12%  Similarity=0.079  Sum_probs=134.1

Q ss_pred             cchHHHHHHHhCCCCC--CCCCcHHHHHHHhcC-CCCcHHHHHHhCcHHHHHHHHhccChhHHHHHHHHHHHHhc-Chhh
Q 044095          136 LAALYLLERSLLPNPP--SDQACQPELMRALCL-AESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCT-VAEG  211 (308)
Q Consensus       136 ~~AI~lLV~LL~~g~~--~~k~~a~a~l~aL~~-~~~Nr~~iV~aGAVp~LVeLL~~~s~~~~E~ALAiL~~La~-~~eG  211 (308)
                      .-.|+.||++|..+..  ..+..+...+.+||. .++||..|+++|+||.||++|.+.+.+..+.|+.+|.+|+. ++++
T Consensus         7 ~~~i~~lV~lL~s~~~~~~~q~~Aa~~l~~L~~~~~~~r~~I~~~G~Ip~LV~lL~s~~~~vq~~Aa~aL~nLa~~~~~n   86 (233)
T 3tt9_A            7 EMTLERAVSMLEADHMLPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVCGALRNLVFEDNDN   86 (233)
T ss_dssp             CCCHHHHHHTCCSSCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHTTHHHHHHHGGGCCCHHHHHHHHHHHHHHHTTCHHH
T ss_pred             hccHHHHHHHhCCCCchHHHHHHHHHHHHHHHcCCcHHHHHHHHcCCHHHHHHHHcCCCHHHHHHHHHHHHHHHhCCHHH
Confidence            4579999999998765  333344567788994 57899999999999999999999899999999999999998 5899


Q ss_pred             HHHHHhccCcHHHHHHHhcC-CCHHHHHHHHHHHHHHhcCCcchhhccCCccHHHHHHHHH---hCC-----------CC
Q 044095          212 AEETRAHALAVPVMVTMMGQ-MAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELAL---QGN-----------CT  276 (308)
Q Consensus       212 r~aI~~~~gaIp~LV~lLr~-gS~~~KE~AVa~L~sLC~~~~~~v~~a~~~gv~~Ll~Lll---qg~-----------cS  276 (308)
                      |.+|.+ .|+|+.||++|++ ++...+|+|+++||+|+..+..+.. +..+|++.|+.++.   .|-           .+
T Consensus        87 k~~I~~-~GaI~~Lv~lL~~~~~~~~~e~a~~aL~nLS~~~~~k~~-i~~~~i~~Lv~ll~~p~sG~~~~~~~~~~~~~~  164 (233)
T 3tt9_A           87 KLEVAE-LNGVPRLLQVLKQTRDLETKKQITGLLWNLSSNDKLKNL-MITEALLTLTENIIIPFSGWPEGDYPKANGLLD  164 (233)
T ss_dssp             HHHHHH-TTHHHHHHHHHHHCCCHHHHHHHHHHHHHHHTSGGGHHH-HHHHHHHHHCCCCCHHHHCCCGGGCCCCCTTCC
T ss_pred             HHHHHH-cCCHHHHHHHHccCCCHHHHHHHHHHHHHHHcChhhHHH-HHhccHHHHHHHHhccccCCcccccccccccch
Confidence            999998 7899999999984 7899999999999999988766653 44567777765442   231           14


Q ss_pred             HHHHHHHHHHHHHHHhcC-CCCCccccccC
Q 044095          277 PRGRRKGTQLLKSLKEYG-QPDTTQDEMNG  305 (308)
Q Consensus       277 ~raKrKA~~LLklL~~~~-e~~~~~~~~~g  305 (308)
                      ...+++|...|+.|.... +++-.+.+..|
T Consensus       165 ~~v~~na~~~L~nLss~~~~~R~~~r~~~G  194 (233)
T 3tt9_A          165 FDIFYNVTGCLRNMSSAGADGRKAMRRCDG  194 (233)
T ss_dssp             HHHHHHHHHHHHHHTTSCHHHHHHHHTSTT
T ss_pred             HHHHHHHHHHHHHHhcCCHHHHHHHHHCCC
Confidence            589999999999998754 44444444333
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 308
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-04
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 39.9 bits (91), Expect = 3e-04
 Identities = 19/129 (14%), Positives = 42/129 (32%), Gaps = 3/129 (2%)

Query: 121 HLAELQLSSGSDSDRLAALYLLERSLLPNPPSDQA--CQPELMRALCLAESNRRVAVEAG 178
            L +L + +  D+ R  ++   ++  +     ++        +  L     NR V     
Sbjct: 401 RLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLN 460

Query: 179 AVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKE 238
            +   ++++          A   L  +    E AE   A   A   +  ++         
Sbjct: 461 TIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEA-EGATAPLTELLHSRNEGVAT 519

Query: 239 YAISVLAVI 247
           YA +VL  +
Sbjct: 520 YAAAVLFRM 528

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.21
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.99
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.99
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.83
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.78
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.75
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 95.62
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 94.64
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 94.26
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 93.41
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 90.91
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 90.66
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 88.6
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 87.94
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 86.99
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 81.89
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 81.84
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Plakophilin 1 helical region
domain: Plakophilin 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.45  E-value=1.5e-13  Score=121.50  Aligned_cols=116  Identities=13%  Similarity=0.142  Sum_probs=103.1

Q ss_pred             chHHHHHHHhCCCCCCCCCcHHHHHHHhcC-CCCcHHHHHHhCcHHHHHHHHhccChhHHHHHHHHHHHHhc-ChhhHHH
Q 044095          137 AALYLLERSLLPNPPSDQACQPELMRALCL-AESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCT-VAEGAEE  214 (308)
Q Consensus       137 ~AI~lLV~LL~~g~~~~k~~a~a~l~aL~~-~~~Nr~~iV~aGAVp~LVeLL~~~s~~~~E~ALAiL~~La~-~~eGr~a  214 (308)
                      .+||.||.+|..+...-+..+..++.+||. +++||..+++.|+|+.|+++|.+.+.+.++.|+.+|.+|+. ++++|..
T Consensus         2 ~~ip~lv~~L~~~~~~~~~~a~~~l~~l~~~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~a~~aL~~L~~~~~~~~~~   81 (457)
T d1xm9a1           2 LTIPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLE   81 (457)
T ss_dssp             CCHHHHHHHHHSSCTHHHHHHHHHHHHHTSSCSSHHHHHHHTTHHHHHHHHTTSSCHHHHHHHHHHHHHHHSSCHHHHHH
T ss_pred             CCHHHHHHHhCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCcHHHHHHHHCCCCHHHHHHHHHHHHHHHcCCHHHHHH
Confidence            369999999998887667666788999996 57899999999999999999999899999999999999995 6788999


Q ss_pred             HHhccCcHHHHHHHhcC-CCHHHHHHHHHHHHHHhcCCcc
Q 044095          215 TRAHALAVPVMVTMMGQ-MAGRGKEYAISVLAVIYGGGDQ  253 (308)
Q Consensus       215 I~~~~gaIp~LV~lLr~-gS~~~KE~AVa~L~sLC~~~~~  253 (308)
                      |.+ .|+|+.|+++++. .....++.|+.+|++|+.....
T Consensus        82 i~~-~g~v~~li~~l~~~~~~~~~~~a~~~l~~l~~~~~~  120 (457)
T d1xm9a1          82 TRR-QNGIREAVSLLRRTGNAEIQKQLTGLLWNLSSTDEL  120 (457)
T ss_dssp             HHH-TTCHHHHHHHHTTCCCHHHHHHHHHHHHHHHTSSST
T ss_pred             HHH-CCChHHHHHHHhccCcHHHHHHHHHHHHHHHhhhhh
Confidence            988 6899999999986 5788899999999999987654
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure