Citrus Sinensis ID: 044104

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
IKDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEEEDSKH
cccccccccccEEEEcccEEEEcccHHHHHHcccEEEEEccccccEECccccEEEEEEEECcccccccccEEEEEEcccccccccccccccccccCEEEEEEccHHHHHHcccHHHHHHHHHHHHccc
*KDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTK*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IKDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEEEDSKH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glycine cleavage system H protein Is also involved in protein lipoylation via its role as an octanoyl/lipoyl carrier protein intermediate.probableB7INR1
Glycine cleavage system H protein The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.probableA4SP34
Glycine cleavage system H protein Is also involved in protein lipoylation via its role as an octanoyl/lipoyl carrier protein intermediate.probableQ6GB23

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HPC, chain A
Confidence level:very confident
Coverage over the Query: 1-128
View the alignment between query and template
View the model in PyMOL