Citrus Sinensis ID: 044104

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
IKDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEEEDSKH
cccccccccccEEEEcccEEEEcccHHHHHHcccEEEEEccccccEEEccccEEEEEEEEEcccccccccEEEEEEcccccccccccccccccccEEEEEEEccHHHHHHcccHHHHHHHHHHHHccc
ccccEEccccEEEEEEccEEEEEEcHHHHHHHccEEEEEccccccEEcEccEEEEEEEcccEEEEEEcccEEEEEEccHHHHcccHHHHccccccccEEEEEccHHHHHHcEcHHHHHHHHHHHHccc
ikdlkyadshewvkvdgnsatigitdhaqdhlgdVVYVElpevgvtvkqdasfgavesvkatsdvnspvsgkVVEVNEelssspalvnsspyedgwIIKVEMDNAGELKKLMDADQYTKFceeedskh
ikdlkyadshewVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVEsvkatsdvnspvsGKVVEVneelssspalvnsspyedGWIIKVEMDNAGELKKLMDADQYTKFCEEEDSKH
IKDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEEEDSKH
*********HEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAV***********************************YEDGWIIKVEMDNAGELKKL*****************
*KDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTK*********
IKDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVV************VNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEEEDSKH
*KDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEEED***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IKDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEEEDSKH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
P49359162 Glycine cleavage system H N/A no 0.976 0.771 0.704 9e-48
Q39732162 Glycine cleavage system H N/A no 0.976 0.771 0.696 2e-47
P16048165 Glycine cleavage system H N/A no 0.976 0.757 0.68 5e-46
Q9LQL0166 Probable glycine cleavage no no 1.0 0.771 0.648 1e-45
P46485165 Glycine cleavage system H N/A no 0.960 0.745 0.682 1e-45
P25855165 Glycine cleavage system H no no 1.0 0.775 0.632 9e-45
A3C6G9164 Glycine cleavage system H no no 0.960 0.75 0.674 2e-44
A2Z9B8164 Glycine cleavage system H N/A no 0.960 0.75 0.674 2e-44
P93255163 Glycine cleavage system H N/A no 0.976 0.766 0.650 3e-42
P49360152 Glycine cleavage system H N/A no 0.898 0.756 0.678 2e-41
>sp|P49359|GCSH_FLAPR Glycine cleavage system H protein, mitochondrial OS=Flaveria pringlei GN=GDCSH PE=2 SV=1 Back     alignment and function desciption
 Score =  188 bits (477), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%)

Query: 4   LKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATS 63
           LKYA+SHEWVK +G+ ATIGITDHAQDHLG+VV+V+LPE G +V +   FGAVESVKATS
Sbjct: 38  LKYANSHEWVKHEGSVATIGITDHAQDHLGEVVFVDLPEAGGSVTKATGFGAVESVKATS 97

Query: 64  DVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEE 123
           DVNSP+SG++VEVN +LS +P L+NSSPYEDGW+IKV+  N  EL  LM A +YTKFCEE
Sbjct: 98  DVNSPISGEIVEVNSKLSETPGLINSSPYEDGWMIKVKPSNPSELDSLMGAKEYTKFCEE 157

Query: 124 EDSKH 128
           EDS H
Sbjct: 158 EDSAH 162
The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.
Flaveria pringlei (taxid: 4226)
>sp|Q39732|GCSH_FLAAN Glycine cleavage system H protein, mitochondrial OS=Flaveria anomala GN=GDCSH PE=2 SV=1 Back     alignment and function description
>sp|P16048|GCSH_PEA Glycine cleavage system H protein, mitochondrial OS=Pisum sativum GN=GDCSH PE=1 SV=1 Back     alignment and function description
>sp|Q9LQL0|GCSH2_ARATH Probable glycine cleavage system H protein 2, mitochondrial OS=Arabidopsis thaliana GN=At1g32470 PE=1 SV=1 Back     alignment and function description
>sp|P46485|GCSH_FLATR Glycine cleavage system H protein, mitochondrial OS=Flaveria trinervia GN=GDCSH PE=2 SV=1 Back     alignment and function description
>sp|P25855|GCSH1_ARATH Glycine cleavage system H protein 1, mitochondrial OS=Arabidopsis thaliana GN=GDCSH PE=1 SV=1 Back     alignment and function description
>sp|A3C6G9|GCSH_ORYSJ Glycine cleavage system H protein, mitochondrial OS=Oryza sativa subsp. japonica GN=GDCSH PE=1 SV=1 Back     alignment and function description
>sp|A2Z9B8|GCSH_ORYSI Glycine cleavage system H protein, mitochondrial OS=Oryza sativa subsp. indica GN=GDCSH PE=2 SV=1 Back     alignment and function description
>sp|P93255|GCSH_MESCR Glycine cleavage system H protein, mitochondrial OS=Mesembryanthemum crystallinum GN=GDCSH PE=2 SV=1 Back     alignment and function description
>sp|P49360|GCSH_FLAPU Glycine cleavage system H protein, mitochondrial (Fragment) OS=Flaveria pubescens GN=GDCSH PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
449455395155 PREDICTED: glycine cleavage system H pro 1.0 0.825 0.828 1e-57
388496274155 unknown [Lotus japonicus] 1.0 0.825 0.835 7e-57
225423730154 PREDICTED: glycine cleavage system H pro 1.0 0.831 0.812 9e-57
351725115155 uncharacterized protein LOC100305815 [Gl 1.0 0.825 0.828 2e-56
357475209155 Glycine cleavage system H protein [Medic 1.0 0.825 0.828 3e-56
356576321174 PREDICTED: glycine cleavage system H pro 1.0 0.735 0.804 7e-56
356576319155 PREDICTED: glycine cleavage system H pro 1.0 0.825 0.804 1e-55
15226906156 glycine cleavage system H protein [Arabi 1.0 0.820 0.812 1e-55
225464818155 PREDICTED: glycine cleavage system H pro 1.0 0.825 0.820 2e-55
363807578155 uncharacterized protein LOC100792708 [Gl 1.0 0.825 0.796 3e-55
>gi|449455395|ref|XP_004145438.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 106/128 (82%), Positives = 121/128 (94%)

Query: 1   IKDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVK 60
           +KDLKYA SHEWVKV+G+ AT+GITDHAQ HLGDVVYVELPEVG +VKQD SFGAVESVK
Sbjct: 28  VKDLKYATSHEWVKVEGDKATVGITDHAQGHLGDVVYVELPEVGTSVKQDGSFGAVESVK 87

Query: 61  ATSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKF 120
           ATSD+NSPVSGK++EVNEELSSSP LVNSSPYE+GWIIKVE+ ++GELKKLMD++QY+KF
Sbjct: 88  ATSDINSPVSGKIIEVNEELSSSPGLVNSSPYENGWIIKVEVSDSGELKKLMDSEQYSKF 147

Query: 121 CEEEDSKH 128
           CEEEDSKH
Sbjct: 148 CEEEDSKH 155

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388496274|gb|AFK36203.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225423730|ref|XP_002278252.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Vitis vinifera] gi|297737954|emb|CBI27155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351725115|ref|NP_001237081.1| uncharacterized protein LOC100305815 [Glycine max] gi|255626687|gb|ACU13688.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357475209|ref|XP_003607890.1| Glycine cleavage system H protein [Medicago truncatula] gi|85719356|gb|ABC75361.1| 2-oxo acid dehydrogenase, lipoyl-binding site [Medicago truncatula] gi|355508945|gb|AES90087.1| Glycine cleavage system H protein [Medicago truncatula] gi|388498488|gb|AFK37310.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356576321|ref|XP_003556281.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356576319|ref|XP_003556280.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|15226906|ref|NP_181057.1| glycine cleavage system H protein [Arabidopsis thaliana] gi|3668097|gb|AAC61829.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana] gi|15810184|gb|AAL06993.1| At2g35120/T4C15.21 [Arabidopsis thaliana] gi|16974361|gb|AAL31106.1| At2g35120/T4C15.21 [Arabidopsis thaliana] gi|110743799|dbj|BAE99735.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana] gi|330253973|gb|AEC09067.1| glycine cleavage system H protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225464818|ref|XP_002269090.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Vitis vinifera] gi|296087512|emb|CBI34101.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|363807578|ref|NP_001242407.1| uncharacterized protein LOC100792708 [Glycine max] gi|255636316|gb|ACU18497.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
TAIR|locus:2063464156 AT2G35120 "AT2G35120" [Arabido 1.0 0.820 0.812 1.3e-54
UNIPROTKB|P16048165 GDCSH "Glycine cleavage system 0.976 0.757 0.68 1e-43
TAIR|locus:2033802166 AT1G32470 "AT1G32470" [Arabido 1.0 0.771 0.648 3.5e-43
TAIR|locus:2062435165 GDCH "AT2G35370" [Arabidopsis 1.0 0.775 0.632 1.9e-42
TIGR_CMR|CHY_0490130 CHY_0490 "glycine cleavage sys 0.960 0.946 0.601 1.5e-35
TIGR_CMR|BA_5228127 BA_5228 "glycine cleavage syst 0.953 0.960 0.540 1.1e-34
UNIPROTKB|O32174127 gcvH "Glycine cleavage system 0.960 0.968 0.560 1.3e-34
UNIPROTKB|Q9KMP5126 gcvH "Glycine cleavage system 0.960 0.976 0.532 1.4e-32
TIGR_CMR|VC_A0277126 VC_A0277 "glycine cleavage sys 0.960 0.976 0.532 1.4e-32
POMBASE|SPBP19A11.01169 gcv3 "glycine decarboxylase co 0.960 0.727 0.528 9.8e-32
TAIR|locus:2063464 AT2G35120 "AT2G35120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 564 (203.6 bits), Expect = 1.3e-54, P = 1.3e-54
 Identities = 104/128 (81%), Positives = 117/128 (91%)

Query:     1 IKDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVK 60
             +KDLKYADSHEWVK+DGN AT GITDHAQDHLGDVVYVELP+VG +V Q  SFGAVESVK
Sbjct:    29 LKDLKYADSHEWVKIDGNKATFGITDHAQDHLGDVVYVELPDVGHSVSQGKSFGAVESVK 88

Query:    61 ATSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKF 120
             ATSD+NSPVSGKVVEVNEEL+ SP LVNSSPYE GWIIKVE+ +AGE +KLMD+D+Y+KF
Sbjct:    89 ATSDINSPVSGKVVEVNEELTESPGLVNSSPYEQGWIIKVELSDAGEAEKLMDSDKYSKF 148

Query:   121 CEEEDSKH 128
             CEEED+KH
Sbjct:   149 CEEEDAKH 156
GO:0004375 "glycine dehydrogenase (decarboxylating) activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0005960 "glycine cleavage complex" evidence=IEA;ISS
GO:0006546 "glycine catabolic process" evidence=IEA;ISS
GO:0019464 "glycine decarboxylation via glycine cleavage system" evidence=IEA
GO:0005524 "ATP binding" evidence=IDA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009749 "response to glucose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
UNIPROTKB|P16048 GDCSH "Glycine cleavage system H protein, mitochondrial" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
TAIR|locus:2033802 AT1G32470 "AT1G32470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062435 GDCH "AT2G35370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0490 CHY_0490 "glycine cleavage system H protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5228 BA_5228 "glycine cleavage system H protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|O32174 gcvH "Glycine cleavage system H protein" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KMP5 gcvH "Glycine cleavage system H protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A0277 VC_A0277 "glycine cleavage system H protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
POMBASE|SPBP19A11.01 gcv3 "glycine decarboxylase complex subunit H (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B7INR1GCSH_BACC2No assigned EC number0.55460.92960.9370yesno
B7HUY1GCSH_BACC7No assigned EC number0.55460.92960.9370yesno
Q8D7G6GCSH_VIBVUNo assigned EC number0.55280.95310.9682yesno
C3PDM2GCSH_BACAANo assigned EC number0.55460.92960.9370yesno
Q49W45GCSH_STAS1No assigned EC number0.54540.94530.9603yesno
Q65F75GCSH_BACLDNo assigned EC number0.54910.95310.9606yesno
Q6GB23GCSH_STAASNo assigned EC number0.52890.94530.9603yesno
Q67N37GCSH_SYMTHNo assigned EC number0.57850.94530.9453yesno
B9J3J0GCSH_BACCQNo assigned EC number0.55460.92960.9370yesno
A5IR11GCSH_STAA9No assigned EC number0.53710.94530.9603yesno
A7X019GCSH_STAA1No assigned EC number0.53710.94530.9603yesno
C3LCC7GCSH_BACACNo assigned EC number0.55460.92960.9370yesno
C0ZL15GCSH_BREBNNo assigned EC number0.59830.95310.9682yesno
B7JEE3GCSH_BACC0No assigned EC number0.55460.92960.9370yesno
C5D7J9GCSH_GEOSWNo assigned EC number0.52450.95310.9606yesno
O32174GCSH_BACSUNo assigned EC number0.56550.95310.9606yesno
Q72Y91GCSH_BACC1No assigned EC number0.55460.92960.9370yesno
A9VNZ4GCSH_BACWKNo assigned EC number0.54540.94530.9527yesno
Q815Y3GCSH_BACCRNo assigned EC number0.54620.92960.9370yesno
Q9K786GCSH_BACHDNo assigned EC number0.57370.95310.9531yesno
A6TZT7GCSH_STAA2No assigned EC number0.53710.94530.9603yesno
Q8NXH7GCSH_STAAWNo assigned EC number0.52890.94530.9603yesno
B7HD14GCSH_BACC4No assigned EC number0.54620.92960.9370yesno
Q6GII3GCSH_STAARNo assigned EC number0.53710.94530.9603yesno
A4SP34GCSH_AERS4No assigned EC number0.53650.95310.9457yesno
P64214GCSH_STAANNo assigned EC number0.53710.94530.9603yesno
Q2YWP4GCSH_STAABNo assigned EC number0.53710.94530.9603yesno
B4UGZ2GCSH_ANASKNo assigned EC number0.51610.96870.9687yesno
P64213GCSH_STAAMNo assigned EC number0.53710.94530.9603yesno
Q81XK8GCSH_BACANNo assigned EC number0.55460.92960.9370yesno
B8JDY7GCSH_ANAD2No assigned EC number0.51610.96870.9687yesno
Q0VLA7GCSH_ALCBSNo assigned EC number0.56550.95310.9531yesno
P49359GCSH_FLAPRNo assigned EC number0.7040.97650.7716N/Ano
Q7MEH8GCSH_VIBVYNo assigned EC number0.55280.95310.9682yesno
A7GUH9GCSH_BACCNNo assigned EC number0.55930.92180.9291yesno
B9DJH3GCSH_STACTNo assigned EC number0.52450.95310.9682yesno
Q6HBR6GCSH_BACHKNo assigned EC number0.55460.92960.9370yesno
C1EY77GCSH_BACC3No assigned EC number0.55460.92960.9370yesno
Q631X9GCSH_BACCZNo assigned EC number0.55460.92960.9370yesno
Q5HQR3GCSH_STAEQNo assigned EC number0.51230.94530.9603yesno
Q4L4R5GCSH_STAHJNo assigned EC number0.55370.94530.9603yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030190001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (154 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00010970001
RecName- Full=Aminomethyltransferase; EC=2.1.2.10;; The glycine cleavage system catalyzes the d [...] (408 aa)
• ••• • 0.981
GSVIVG00016572001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (1046 aa)
• ••  • 0.918
GSVIVG00032211001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (1053 aa)
• ••  • 0.917
GSVIVG00019672001
RecName- Full=Dihydrolipoyl dehydrogenase; EC=1.8.1.4; (502 aa)
•     • 0.553
GSVIVG00024726001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (594 aa)
•     • 0.526
GSVIVG00032161001
RecName- Full=Serine hydroxymethyltransferase; EC=2.1.2.1;; Interconversion of serine and glyci [...] (428 aa)
•     • 0.460
GSVIVG00022341001
SubName- Full=Chromosome chr14 scaffold_26, whole genome shotgun sequence; (392 aa)
      • 0.414

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
PRK01202127 PRK01202, PRK01202, glycine cleavage system protei 9e-67
COG0509131 COG0509, GcvH, Glycine cleavage system H protein ( 4e-55
pfam01597122 pfam01597, GCV_H, Glycine cleavage H-protein 6e-55
cd0684896 cd06848, GCS_H, Glycine cleavage H-protein 6e-49
TIGR00527128 TIGR00527, gcvH, glycine cleavage system H protein 7e-47
PRK13380144 PRK13380, PRK13380, glycine cleavage system protei 9e-43
PRK00624114 PRK00624, PRK00624, glycine cleavage system protei 1e-19
TIGR03077110 TIGR03077, not_gcvH, glycine cleavage protein H-li 1e-18
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ 5e-15
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 1e-04
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 2e-04
>gnl|CDD|234918 PRK01202, PRK01202, glycine cleavage system protein H; Provisional Back     alignment and domain information 
 Score =  197 bits (503), Expect = 9e-67
 Identities = 72/122 (59%), Positives = 91/122 (74%)

Query: 2   KDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKA 61
            DLKY  SHEWV+V+G++AT+GITDHAQ+ LGD+V+VELPEVG  VK   +FG VESVKA
Sbjct: 6   ADLKYTKSHEWVRVEGDTATVGITDHAQEQLGDIVFVELPEVGDEVKAGETFGVVESVKA 65

Query: 62  TSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFC 121
            SD+ +PVSG+VVEVNE L  SP LVN  PY +GW+ K++  +  EL  L+DA+ Y    
Sbjct: 66  ASDIYAPVSGEVVEVNEALEDSPELVNEDPYGEGWLFKIKPSDESELDDLLDAEAYEALI 125

Query: 122 EE 123
           EE
Sbjct: 126 EE 127

Length = 127
>gnl|CDD|223583 COG0509, GcvH, Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|201881 pfam01597, GCV_H, Glycine cleavage H-protein Back     alignment and domain information
>gnl|CDD|133457 cd06848, GCS_H, Glycine cleavage H-protein Back     alignment and domain information
>gnl|CDD|200024 TIGR00527, gcvH, glycine cleavage system H protein Back     alignment and domain information
>gnl|CDD|237370 PRK13380, PRK13380, glycine cleavage system protein H; Provisional Back     alignment and domain information
>gnl|CDD|167014 PRK00624, PRK00624, glycine cleavage system protein H; Provisional Back     alignment and domain information
>gnl|CDD|132121 TIGR03077, not_gcvH, glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
COG0509131 GcvH Glycine cleavage system H protein (lipoate-bi 100.0
TIGR00527127 gcvH glycine cleavage system H protein. The genome 100.0
PRK01202127 glycine cleavage system protein H; Provisional 100.0
PRK13380144 glycine cleavage system protein H; Provisional 100.0
PF01597122 GCV_H: Glycine cleavage H-protein; InterPro: IPR00 100.0
KOG3373172 consensus Glycine cleavage system H protein (lipoa 100.0
TIGR03077110 not_gcvH glycine cleavage protein H-like protein, 100.0
PRK00624114 glycine cleavage system protein H; Provisional 100.0
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage 100.0
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 99.43
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 98.82
KOG3266172 consensus Predicted glycine cleavage system H prot 98.74
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 98.69
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 98.66
PRK0674883 hypothetical protein; Validated 98.41
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 98.38
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 98.26
PRK0705180 hypothetical protein; Validated 98.24
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 98.22
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 98.18
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 98.1
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.1
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 98.06
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 98.0
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 97.88
PLN02226 463 2-oxoglutarate dehydrogenase E2 component 97.85
PRK14042596 pyruvate carboxylase subunit B; Provisional 97.81
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 97.78
PRK14040593 oxaloacetate decarboxylase; Provisional 97.77
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 97.74
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 97.65
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 97.64
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 97.63
PRK05704 407 dihydrolipoamide succinyltransferase; Validated 97.59
PRK09282592 pyruvate carboxylase subunit B; Validated 97.57
COG10381149 PycA Pyruvate carboxylase [Energy production and c 97.56
PRK129991146 pyruvate carboxylase; Reviewed 97.55
TIGR01347 403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 97.46
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 97.27
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 97.25
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 97.24
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 97.22
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 97.19
PF13375101 RnfC_N: RnfC Barrel sandwich hybrid domain 97.16
PF09891150 DUF2118: Uncharacterized protein conserved in arch 97.13
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 97.09
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 97.02
PLN02528 416 2-oxoisovalerate dehydrogenase E2 component 96.98
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 96.9
KOG0559 457 consensus Dihydrolipoamide succinyltransferase (2- 96.84
TIGR01349 435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 96.79
PRK11856 411 branched-chain alpha-keto acid dehydrogenase subun 96.78
PLN02744 539 dihydrolipoyllysine-residue acetyltransferase comp 96.6
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 96.27
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 96.26
PF05896 257 NQRA: Na(+)-translocating NADH-quinone reductase s 96.15
KOG03691176 consensus Pyruvate carboxylase [Energy production 96.1
PRK05352 448 Na(+)-translocating NADH-quinone reductase subunit 96.02
PRK09783 409 copper/silver efflux system membrane fusion protei 95.97
PRK05035 695 electron transport complex protein RnfC; Provision 95.77
TIGR01945 435 rnfC electron transport complex, RnfABCDGE type, C 95.58
TIGR01936 447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 95.52
KOG0557 470 consensus Dihydrolipoamide acetyltransferase [Ener 95.41
KOG0238670 consensus 3-Methylcrotonyl-CoA carboxylase, biotin 95.05
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 95.01
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 94.69
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 94.42
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 94.4
COG4656 529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 94.34
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 94.24
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxyla 94.15
TIGR01730 322 RND_mfp RND family efflux transporter, MFP subunit 94.13
COG3608331 Predicted deacylase [General function prediction o 93.95
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterize 93.7
PRK09578 385 periplasmic multidrug efflux lipoprotein precursor 93.54
COG4072161 Uncharacterized protein conserved in archaea [Func 93.54
PRK11578 370 macrolide transporter subunit MacA; Provisional 93.17
PRK09859 385 multidrug efflux system protein MdtE; Provisional 93.16
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 92.86
COG1726 447 NqrA Na+-transporting NADH:ubiquinone oxidoreducta 92.83
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 92.74
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 92.4
TIGR00830121 PTBA PTS system, glucose subfamily, IIA component. 88.36
KOG0368 2196 consensus Acetyl-CoA carboxylase [Lipid transport 88.26
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s 87.21
PF0783175 PYNP_C: Pyrimidine nucleoside phosphorylase C-term 85.14
PRK09439169 PTS system glucose-specific transporter subunit; P 84.64
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 84.59
PRK10476 346 multidrug resistance protein MdtN; Provisional 80.02
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=9.1e-48  Score=273.44  Aligned_cols=123  Identities=58%  Similarity=0.963  Sum_probs=119.3

Q ss_pred             CCCcccCCCceEEEEeC-CEEEEecChhhhhhcCCeeEEEcCCCCcEecCCCeEEEEEEccccceeecCcceEEEEEehh
Q 044104            1 IKDLKYADSHEWVKVDG-NSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEE   79 (128)
Q Consensus         1 P~~~~y~~~h~Wv~~~~-~~~~vGit~~a~~~lG~i~~v~lp~~G~~v~~g~~l~~iEs~k~~~~i~sPvsG~V~~vN~~   79 (128)
                      |++++|+.+|+||+.++ ++++||||++||+++|+|+||+||++|++|++|+++++|||.|++++++||++|+|+++|++
T Consensus         6 p~~l~Y~~~heWvr~e~d~~~tvGiT~~aq~~lGdiv~Velpe~G~~v~~g~~~~~vESvKaasdvyaPvsGeVvevN~~   85 (131)
T COG0509           6 PDDLKYTAEHEWVRVEGDGTATVGITDYAQDQLGDIVFVELPEVGAEVKAGESLAVVESVKAASDVYAPVSGEVVEVNEA   85 (131)
T ss_pred             cccceeccceEEEEecCCCEEEEeCCHHHHHhcCCEEEEEcCCCCCeecCCCeEEEEEeeeeeccccCCCceeEEEechh
Confidence            88999999999999997 69999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCCcccCCCCCCCcEEEEEECCh-hhHhhcCCHHHHHHHHhh
Q 044104           80 LSSSPALVNSSPYEDGWIIKVEMDNA-GELKKLMDADQYTKFCEE  123 (128)
Q Consensus        80 l~~~P~lln~dpy~~gWl~~i~~~~~-~~~~~Ll~~~~Y~~~~~~  123 (128)
                      |.++|+++|++||++|||++|+++|+ ++++.||++++|.++++.
T Consensus        86 l~~~PeliN~dPyg~gWi~klk~~d~~~~~~~L~~~~~y~~~~~~  130 (131)
T COG0509          86 LVDSPELINSDPYGEGWIVKLKPADPSEELEALLDAEAYAELLKE  130 (131)
T ss_pred             hhcChhhhccCCCCCceEEEEeeCChHHHHHhccCHHHHHHHhhc
Confidence            99999999999999999999999996 559999999999999875

>TIGR00527 gcvH glycine cleavage system H protein Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>KOG3266 consensus Predicted glycine cleavage system H protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain Back     alignment and domain information
>PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] Back     alignment and domain information
>KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>COG4072 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component Back     alignment and domain information
>KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
1hpc_A131 Refined Structures At 2 Angstroms And 2.2 Angstroms 8e-47
2ka7_A124 Nmr Solution Structure Of Tm0212 At 40 C Length = 1 9e-34
1zko_A136 Crystal Structure Of Glycine Cleavage System H Prot 9e-33
2edg_A130 Solution Structure Of The Gcv_h Domain From Mouse G 5e-31
3klr_A125 Bovine H-Protein At 0.88 Angstrom Resolution Length 1e-30
1onl_A128 Crystal Structure Of Thermus Thermophilus Hb8 H-Pro 3e-30
3a7a_B128 Crystal Structure Of E. Coli Lipoate-protein Ligase 9e-30
3a8i_E129 Crystal Structure Of Et-Ehred-5-Ch3-Thf Complex Len 4e-29
3hgb_A155 Crystal Structure Of Glycine Cleavage System Protei 9e-27
3ift_A142 Crystal Structure Of Glycine Cleavage System Protei 1e-26
3mxu_A143 Crystal Structure Of Glycine Cleavage System Protei 7e-24
3tzu_A137 Crystal Structure Of A Glycine Cleavage System H Pr 6e-19
>pdb|1HPC|A Chain A, Refined Structures At 2 Angstroms And 2.2 Angstroms Of The Two Forms Of The H-Protein, A Lipoamide-Containing Protein Of The Glycine Decarboxylase Length = 131 Back     alignment and structure 
Iteration: 1

 Score =  181 bits (460), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 104/125 (83%)
Query: 4   LKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATS 63
           LKYA SHEWVK +G+ ATIGITDHAQDHLG+VV+VELPE GV+V +   FGAVESVKATS
Sbjct: 7   LKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATS 66
Query: 64  DVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEE 123
           DVNSP+SG+V+EVN  L+  P L+NSSPYEDGW+IK++  +  EL+ L+ A +YTKFCEE
Sbjct: 67  DVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEE 126
Query: 124 EDSKH 128
           ED+ H
Sbjct: 127 EDAAH 131
>pdb|2KA7|A Chain A, Nmr Solution Structure Of Tm0212 At 40 C Length = 124 Back     alignment and structure
>pdb|1ZKO|A Chain A, Crystal Structure Of Glycine Cleavage System H Protein (Tm0212) From Thermotoga Maritima At 1.65 A Resolution Length = 136 Back     alignment and structure
>pdb|2EDG|A Chain A, Solution Structure Of The Gcv_h Domain From Mouse Glycine Length = 130 Back     alignment and structure
>pdb|3KLR|A Chain A, Bovine H-Protein At 0.88 Angstrom Resolution Length = 125 Back     alignment and structure
>pdb|1ONL|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8 H-Protein Of The Glycine Cleavage System Length = 128 Back     alignment and structure
>pdb|3A7A|B Chain B, Crystal Structure Of E. Coli Lipoate-protein Ligase A In Complex With Octyl-amp And Apoh-protein Length = 128 Back     alignment and structure
>pdb|3A8I|E Chain E, Crystal Structure Of Et-Ehred-5-Ch3-Thf Complex Length = 129 Back     alignment and structure
>pdb|3HGB|A Chain A, Crystal Structure Of Glycine Cleavage System Protein H From Mycobacterium Tuberculosis Length = 155 Back     alignment and structure
>pdb|3IFT|A Chain A, Crystal Structure Of Glycine Cleavage System Protein H From Mycobacterium Tuberculosis, Using X-Rays From The Compact L Source Length = 142 Back     alignment and structure
>pdb|3MXU|A Chain A, Crystal Structure Of Glycine Cleavage System Protein H From Henselae Length = 143 Back     alignment and structure
>pdb|3TZU|A Chain A, Crystal Structure Of A Glycine Cleavage System H Protein (Gcvh) From Mycobacterium Marinum Length = 137 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
1hpc_A131 H protein of the glycine cleavage system; transit 5e-72
1zko_A136 Glycine cleavage system H protein; TM0212, structu 2e-70
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 1e-69
3klr_A125 Glycine cleavage system H protein; antiparallel be 3e-69
3mxu_A143 Glycine cleavage system H protein; seattle structu 3e-68
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 9e-67
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 8e-65
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 4e-60
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Length = 131 Back     alignment and structure
 Score =  210 bits (536), Expect = 5e-72
 Identities = 85/127 (66%), Positives = 104/127 (81%)

Query: 2   KDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKA 61
             LKYA SHEWVK +G+ ATIGITDHAQDHLG+VV+VELPE GV+V +   FGAVESVKA
Sbjct: 5   DGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKA 64

Query: 62  TSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFC 121
           TSDVNSP+SG+V+EVN  L+  P L+NSSPYEDGW+IK++  +  EL+ L+ A +YTKFC
Sbjct: 65  TSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFC 124

Query: 122 EEEDSKH 128
           EEED+ H
Sbjct: 125 EEEDAAH 131
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Length = 136 Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Length = 128 Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} PDB: 2edg_A Length = 125 Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Length = 143 Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Length = 128 Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Length = 155 Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Length = 137 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
3klr_A125 Glycine cleavage system H protein; antiparallel be 100.0
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 100.0
1hpc_A131 H protein of the glycine cleavage system; transit 100.0
3mxu_A143 Glycine cleavage system H protein; seattle structu 100.0
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 100.0
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 100.0
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 100.0
1zko_A136 Glycine cleavage system H protein; TM0212, structu 100.0
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 98.74
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 98.58
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 98.52
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 98.5
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 98.49
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 98.47
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 98.46
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 98.46
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 98.41
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 98.39
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 98.37
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 98.36
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 98.32
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 98.3
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 98.28
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 98.21
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 98.21
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 98.2
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 98.2
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 98.11
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 98.04
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 97.86
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 97.78
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 97.68
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 97.62
1zy8_K 229 Pyruvate dehydrogenase protein X component, mitoch 97.49
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 97.46
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 97.2
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 97.11
3d4r_A169 Domain of unknown function from the PFAM-B_34464; 97.01
3ne5_B 413 Cation efflux system protein CUSB; transmembrane h 96.03
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 95.84
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 95.78
3lnn_A 359 Membrane fusion protein (MFP) heavy metal cation Z 95.57
2f1m_A 277 Acriflavine resistance protein A; helical hairpin, 95.54
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 95.4
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 95.29
1vf7_A 369 Multidrug resistance protein MEXA; alpha hairpin, 94.86
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 93.47
2qj8_A332 MLR6093 protein; structural genomics, joint center 93.38
2auk_A190 DNA-directed RNA polymerase beta' chain; sandwich- 85.87
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A Back     alignment and structure
Probab=100.00  E-value=1.5e-49  Score=281.49  Aligned_cols=124  Identities=46%  Similarity=0.850  Sum_probs=120.7

Q ss_pred             CCcccCCCceEEEEeCCEEEEecChhhhhhcCCeeEEEcCCCCcEecCCCeEEEEEEccccceeecCcceEEEEEehhhh
Q 044104            2 KDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEELS   81 (128)
Q Consensus         2 ~~~~y~~~h~Wv~~~~~~~~vGit~~a~~~lG~i~~v~lp~~G~~v~~g~~l~~iEs~k~~~~i~sPvsG~V~~vN~~l~   81 (128)
                      .+|+||++|+||+.+++.++||||+|||+++|+|+||+||++|++|++|++|++|||.|++++|+||++|+|+++|.+|.
T Consensus         1 ~~l~Yt~~HeWv~~e~~~~~vGITd~Aq~~lGdiv~velp~vG~~v~~G~~~~~VES~K~~sdi~aPvsG~VvevN~~l~   80 (125)
T 3klr_A            1 SVRKFTEKHEWVTTENGVGTVGISNFAQEALGDVVYCSLPEVGTKLNKQEEFGALESVKAASELYSPLSGEVTEINKALA   80 (125)
T ss_dssp             CCCEECTTSEEEEEETTEEEEEECHHHHHHHCSEEEEECCCTTCEECTTCEEEEEEESSCEEEEECSSSEEEEEECGGGT
T ss_pred             CCcEeCCCCEEEEEcCCEEEEeeCHHHHhhCCCeEEEEeCCCCCEEcCCCEEEEEEEcceeeeeecCCCEEEEEEhhhhh
Confidence            37899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCcccCCCCCCCcEEEEEECChhhHhhcCCHHHHHHHHhhhc
Q 044104           82 SSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEEED  125 (128)
Q Consensus        82 ~~P~lln~dpy~~gWl~~i~~~~~~~~~~Ll~~~~Y~~~~~~e~  125 (128)
                      ++|++||++||++|||++|++++++++++||++++|+++|++.+
T Consensus        81 ~~P~liN~dpy~~gWl~ki~~~~~~e~~~Ll~~~~Y~~~~~~~~  124 (125)
T 3klr_A           81 ENPGLVNKSCYEDGWLIKMTFSNPSELDELMSEEAYEKYIKSIE  124 (125)
T ss_dssp             TCTTHHHHCTTTTTCCEEEEESCGGGGGGSBCHHHHHHHHHHHH
T ss_pred             hChHhhcCCCCCCceEEEEEECCHHHHHhcCCHHHHHHHHhhhc
Confidence            99999999999999999999999999999999999999998753
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 128
d1onla_127 b.84.1.1 (A:) Protein H of glycine cleavage system 3e-50
d1hpca_131 b.84.1.1 (A:) Protein H of glycine cleavage system 1e-49
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Length = 127 Back     information, alignment and structure

class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Single hybrid motif
family: Biotinyl/lipoyl-carrier proteins and domains
domain: Protein H of glycine cleavage system
species: Thermus thermophilus [TaxId: 274]

 Score =  153 bits (389), Expect = 3e-50
 Identities = 60/123 (48%), Positives = 84/123 (68%)

Query: 2   KDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKA 61
           KD  Y  +HEW   +G++  +GITD+AQD LGDVVYVELPEVG  V++  +   VESVK 
Sbjct: 4   KDRFYTKTHEWALPEGDTVLVGITDYAQDALGDVVYVELPEVGRVVEKGEAVAVVESVKT 63

Query: 62  TSDVNSPVSGKVVEVNEELSSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFC 121
            SD+ +PV+G++VEVN  L  +P LVN  PY +GWI +++  + G+L +L+DA  Y +  
Sbjct: 64  ASDIYAPVAGEIVEVNLALEKTPELVNQDPYGEGWIFRLKPRDMGDLDELLDAGGYQEVL 123

Query: 122 EEE 124
           E E
Sbjct: 124 ESE 126
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Length = 131 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d1hpca_131 Protein H of glycine cleavage system {Pea (Pisum s 100.0
d1onla_127 Protein H of glycine cleavage system {Thermus ther 100.0
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 98.74
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 98.61
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 98.55
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 98.51
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 98.49
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 98.47
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 98.39
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 98.35
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 98.27
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 98.02
d1brwa3103 Pyrimidine nucleoside phosphorylase {Bacillus stea 81.09
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 80.24
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Single hybrid motif
family: Biotinyl/lipoyl-carrier proteins and domains
domain: Protein H of glycine cleavage system
species: Pea (Pisum sativum) [TaxId: 3888]

Probab=100.00  E-value=1.1e-49  Score=282.70  Aligned_cols=128  Identities=66%  Similarity=1.098  Sum_probs=126.2

Q ss_pred             CCCcccCCCceEEEEeCCEEEEecChhhhhhcCCeeEEEcCCCCcEecCCCeEEEEEEccccceeecCcceEEEEEehhh
Q 044104            1 IKDLKYADSHEWVKVDGNSATIGITDHAQDHLGDVVYVELPEVGVTVKQDASFGAVESVKATSDVNSPVSGKVVEVNEEL   80 (128)
Q Consensus         1 P~~~~y~~~h~Wv~~~~~~~~vGit~~a~~~lG~i~~v~lp~~G~~v~~g~~l~~iEs~k~~~~i~sPvsG~V~~vN~~l   80 (128)
                      |++++||++|+|++.+++.+|||||+|||+++|+|++|++|++|++|++|++|++|||.|++.+|+||++|+|+++|.+|
T Consensus         4 ~~~~~Yt~~H~Wv~~e~~~~~vGit~~a~~~lG~i~~v~lp~~g~~v~~g~~~~~iEs~k~~~~i~sPv~G~vv~vN~~l   83 (131)
T d1hpca_           4 LDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGL   83 (131)
T ss_dssp             CTTCEECTTSEEEEEETTEEEEEECHHHHHHHCSEEEEECCCTTCEECBTSEEEEEEESSCEEEEEBSSCEEEEEECTHH
T ss_pred             cCcceeCCCeEEEEecCCEEEEEECHHHHhhhhhheeecCCCCCccccCCCceEEEEeecccccccCCcchhheeehhhh
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCcccCCCCCCCcEEEEEECChhhHhhcCCHHHHHHHHhhhccCC
Q 044104           81 SSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFCEEEDSKH  128 (128)
Q Consensus        81 ~~~P~lln~dpy~~gWl~~i~~~~~~~~~~Ll~~~~Y~~~~~~e~~~~  128 (128)
                      .++|++||++||++|||++|++.+++++++||++++|.+|+++++++|
T Consensus        84 ~~~P~llN~dpy~~gWl~~i~~~d~~~~~~Ll~~~~Y~~~~~e~~~~~  131 (131)
T d1hpca_          84 TGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH  131 (131)
T ss_dssp             HHCTTHHHHCTTTTTCCEEEEESSGGGGGGSBCHHHHHHHHHHHHHCC
T ss_pred             hhCHHHHhCCCCCCcEEEEEEECCHHHHHhCCCHHHHHHHHhhhhccC
Confidence            999999999999999999999999999999999999999999999887
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure